BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j05r (761 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 27 2.9 SPAC328.08c |||tubulin specific chaperone cofactor C |Schizosacc... 27 3.9 >SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/53 (28%), Positives = 21/53 (39%) Frame = -2 Query: 373 DPPLPHRVHVPFAPGYICAY*IVVALCLY*VFVTSCYYCFKFSFCYGFYSFKF 215 DP R + +C IV A C+Y VF+ Y + FY + F Sbjct: 319 DPAYAIRTALTRGVRLLCTEPIVQAFCMYLVFINILLYICMVGYPLIFYQYGF 371 >SPAC328.08c |||tubulin specific chaperone cofactor C |Schizosaccharomyces pombe|chr 1|||Manual Length = 259 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 150 IYASDDSDSSLCQR*GANSFHQLRCYHKFNLR 55 I+ SD +DS++C S HQ R +H NLR Sbjct: 183 IHLSDINDSTICV-----SCHQFRLHHSTNLR 209 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,911,772 Number of Sequences: 5004 Number of extensions: 55365 Number of successful extensions: 122 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -