BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j05r (761 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY029257-1|AAK38745.1| 1342|Homo sapiens WD repeat membrane prot... 33 0.84 AB046858-1|BAB13464.1| 905|Homo sapiens KIAA1638 protein protein. 33 0.84 >AY029257-1|AAK38745.1| 1342|Homo sapiens WD repeat membrane protein protein. Length = 1342 Score = 33.5 bits (73), Expect = 0.84 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = +3 Query: 522 DKCRVLSEMSFKPNKLLTLDILLYIVETNVCGYFYI*YKEFNKDSKRPFAV 674 DKCR+L LT D L+Y +T V YFYI +F D + P +V Sbjct: 474 DKCRILCHA-------LTSDFLIYGTDTGVVQYFYIEDWQFVNDYRHPVSV 517 >AB046858-1|BAB13464.1| 905|Homo sapiens KIAA1638 protein protein. Length = 905 Score = 33.5 bits (73), Expect = 0.84 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = +3 Query: 522 DKCRVLSEMSFKPNKLLTLDILLYIVETNVCGYFYI*YKEFNKDSKRPFAV 674 DKCR+L LT D L+Y +T V YFYI +F D + P +V Sbjct: 140 DKCRILCHA-------LTSDFLIYGTDTGVVQYFYIEDWQFVNDYRHPVSV 183 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,576,608 Number of Sequences: 237096 Number of extensions: 1916367 Number of successful extensions: 3061 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3061 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -