BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j03r (551 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.2 S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 22 4.8 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 8.3 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.2 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +2 Query: 326 TRIGSTSSLTKATVTT--LSTCLCVFADTGAG 415 ++ GST + T ATVTT +T L + TG G Sbjct: 206 SKAGSTDASTPATVTTTGATTTLPAASATGTG 237 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 234 RCLSIFLAVLYFRSNFLRTLCLC 302 RC+ +FL+V+ S F+ + C Sbjct: 6 RCIYLFLSVILITSYFVTPVMPC 28 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 8.3 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 4 AASSSLAKVCSSFLLLGGNTFLAALAMPPLLYCGGPQPG 120 AAS +L K + L G +T AA PP + G G Sbjct: 27 AASLTLVKAETPEHLAGTSTTAAATPTPPSVPVGSAVAG 65 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,336 Number of Sequences: 438 Number of extensions: 3219 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -