BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j01r (796 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 4.9 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 8.6 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +1 Query: 529 NWFIHDVHRGDL*IGVLNWSIDVVYE 606 N+FI + DL +G++N D++++ Sbjct: 60 NYFITHLALADLSVGLINVLTDIIWK 85 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 456 LDEDGNGLVIVDLP-IEAQPEDLEKAQLVDLPVENVAEPEDLSP 328 L+ +G+ + V + ++ P++ LVD+ + E EDL+P Sbjct: 428 LNNEGSLVYNVQIENLKTTPDNTTFITLVDVSTKRRTELEDLTP 471 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,100 Number of Sequences: 336 Number of extensions: 3419 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -