BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j01r (796 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 31 0.054 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 26 1.2 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 1.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 2.7 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 2.7 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 2.7 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 24 6.2 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 24 6.2 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 30.7 bits (66), Expect = 0.054 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 596 TSMLQLRTPIYKSPL*TSWMNQLKRRMRKSRM 501 TS L TPI++SP W N+ R ++K RM Sbjct: 317 TSALLSCTPIFRSPPNPPWSNRTLRNLKKDRM 348 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 430 NKSVSIFVQFSR-IFNPADRANFTVIL 507 +KS+S +Q + +F P D NF VIL Sbjct: 118 SKSISGLIQVDKPVFKPGDTVNFRVIL 144 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.8 bits (54), Expect = 1.5 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +3 Query: 543 RCSQGRLVNRRPQLEHRRCLRS*QNQPGHRRPQLEHRRCLRSLQNQPG-HRRPQLEHRGF 719 +C+Q +E RRC R +N+ + L+ C +Q+ HR E Sbjct: 998 QCNQYGQCPCNDNVEGRRCDRCKENKYDRHQGCLDCPACYNLVQDAANDHRAKLAELNQI 1057 Query: 720 LRSLQSQP 743 L+ +QS+P Sbjct: 1058 LQDIQSKP 1065 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.7 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 371 STSWAFSKSSGCASIGRS-TITSPFPSSSNSA 463 S +W+ S SG SIG T T+ P SS S+ Sbjct: 489 SGNWSASSESGRTSIGSEITTTNTHPKSSASS 520 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.0 bits (52), Expect = 2.7 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 371 STSWAFSKSSGCASIGRS-TITSPFPSSSNSA 463 S +W+ S SG SIG T T+ P SS S+ Sbjct: 490 SGNWSASSESGRTSIGSEITTTNTHPKSSASS 521 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.0 bits (52), Expect = 2.7 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +3 Query: 573 RPQLEHRRCLRS*QNQPGHRRPQLEHRRCLRSLQNQPGHRRPQLEHRGFLRSLQSQPGNR 752 +PQ HR + Q Q ++ Q + ++ + Q+QP + QL L + S P + Sbjct: 1292 QPQQLHRSQQQQQQQQQQQQQQQQQQQQQQQQQQHQPPSTQAQLRPSAPLNT--SPPNSW 1349 Query: 753 HPH 761 H H Sbjct: 1350 HSH 1352 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.8 bits (49), Expect = 6.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 592 DVVYEADRISRDIGVLNWSIDVVYE 666 D+ EAD+I +D+ L ID +YE Sbjct: 294 DLNREADQIKQDVADLERWIDRIYE 318 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.8 bits (49), Expect = 6.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 592 DVVYEADRISRDIGVLNWSIDVVYE 666 D+ EAD+I +D+ L ID +YE Sbjct: 294 DLNREADQIKQDVADLERWIDRIYE 318 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 705,720 Number of Sequences: 2352 Number of extensions: 14556 Number of successful extensions: 56 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -