BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11j01f (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g25540.1 68414.m03171 phytochrome and flowering time regulato... 32 0.22 At3g18840.1 68416.m02392 pentatricopeptide (PPR) repeat-containi... 30 0.89 At5g62580.1 68418.m07855 expressed protein 29 2.0 At1g20060.1 68414.m02511 kinesin motor protein-related 29 2.7 At4g25270.1 68417.m03635 pentatricopeptide (PPR) repeat-containi... 28 3.6 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 28 3.6 At3g20540.1 68416.m02600 DNA-directed DNA polymerase family prot... 28 4.7 At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR... 28 4.7 At1g17440.2 68414.m02133 transcription initiation factor IID (TF... 28 4.7 At1g17440.1 68414.m02132 transcription initiation factor IID (TF... 28 4.7 At5g63290.1 68418.m07943 coproporphyrinogen oxidase-related low ... 27 6.2 At2g22610.1 68415.m02680 kinesin motor protein-related 27 6.2 At3g53380.1 68416.m05891 lectin protein kinase family protein co... 27 8.3 At3g28520.1 68416.m03562 AAA-type ATPase family protein contains... 27 8.3 At1g62480.1 68414.m07050 vacuolar calcium-binding protein-relate... 27 8.3 >At1g25540.1 68414.m03171 phytochrome and flowering time regulatory protein (PFT1) PMID: 12815435 Length = 836 Score = 32.3 bits (70), Expect = 0.22 Identities = 27/127 (21%), Positives = 54/127 (42%), Gaps = 8/127 (6%) Frame = -1 Query: 536 PRCSQGRLVNRRPQLEHRRCLRS*QNQPGH----RRPQLEHRRCLRSLQNQPGHRRPQLE 369 P Q + Q + ++ ++ Q Q H + PQL+ ++ Q Q H+ QL+ Sbjct: 679 PNQQQQQQQQLHQQQQQQQQIQQQQQQQQHLQQQQMPQLQQQQQQHQQQQQQQHQLSQLQ 738 Query: 368 HRGFLRSLQSQPGNRHSQLELRHFLRSLQNQQGNRRCQREF----QCQKSQRCLHFRSIQ 201 H + Q Q +H +L+H + Q + Q++ Q Q+ L+ Q Sbjct: 739 HHQQQQQQQQQQQQQHQLTQLQHHHQQQQQASPLNQMQQQTSPLNQMQQQTSPLNQMQQQ 798 Query: 200 SRPRRVL 180 +P++++ Sbjct: 799 QQPQQMV 805 >At3g18840.1 68416.m02392 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 698 Score = 30.3 bits (65), Expect = 0.89 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = -2 Query: 352 EAYRVSREIGILNWSFDIFYEVYRINREIDVVNGNFNVKNRNVV 221 EAY +S E G D++ + YR+++ I+++ G V+ V+ Sbjct: 522 EAYNISPETGHYTCMIDLYGKAYRLDKAIELMEGIDQVEKDAVI 565 >At5g62580.1 68418.m07855 expressed protein Length = 615 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 87 HQSNPSKSRISQYRNTKASTLECTSSPTKSFKNSP 191 H S S SR+S YRN A T E +S + F SP Sbjct: 541 HDSKYSASRMSTYRNRNAETTEIQNSRHR-FNGSP 574 >At1g20060.1 68414.m02511 kinesin motor protein-related Length = 951 Score = 28.7 bits (61), Expect = 2.7 Identities = 29/105 (27%), Positives = 42/105 (40%), Gaps = 8/105 (7%) Frame = +2 Query: 119 PIPKYESIDAGM--YIIPD-EVIQELALAGIELSENVDNVAIFDIEIPVDNVDFPVDSVN 289 P+P ++D I P E E + LS+NV + + + +N P SVN Sbjct: 692 PVPNVRNVDVDSCNLINPRREASTEESSESPVLSKNVKDAELVPCHLSSENDAEPRQSVN 751 Query: 290 FVENVEAPVENADFPADSVSFV--ENLDAPV---EDADVLADSVN 409 ENV P A+ F +N D P E +V D +N Sbjct: 752 SEENVGIPSTITHVEAEVTDFQRDQNQDDPTPSPEQVEVSQDCIN 796 >At4g25270.1 68417.m03635 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 527 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 54 LSSHSLERRPPHQSNPSKSRISQYRNTKASTLECTS-SPT 170 +SS S++++P H + R +QY N ++L T SPT Sbjct: 16 VSSSSMKKKPRHHQQLKQHRQNQYNNNGFTSLSFTKPSPT 55 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +3 Query: 54 LSSHSLERRPPHQSNPSKSRISQYRNTKASTLECTSSPTKSFKNSPWPGLN 206 +S E +PP S P + ++ YR ++ +L +S + KNS GLN Sbjct: 306 MSPKRSEPKPPVISTPEPAELTDYRFVRSPSLS-LASLSSGLKNSDEVGLN 355 >At3g20540.1 68416.m02600 DNA-directed DNA polymerase family protein similar to PolI-like DNA polymerase [Oryza sativa] GI:19912795; contains Pfam profiles PF01612: 3'-5' exonuclease, PF00476: DNA polymerase I family A Length = 1034 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 105 KSRISQYRNTKASTLECTSSPTKSFKNSPWPGLN 206 K R +++RN K + PT+ F S WP ++ Sbjct: 590 KKRATKFRNIKLHRISDRPLPTEKFTASGWPSVS 623 >At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 897 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -2 Query: 460 ISRDIGVLNWSIDVVYEVYRISQDIGVLNWSIEVFYE 350 +S++ +WS+D + E+ + +DIG + + VFYE Sbjct: 73 LSKNYASSSWSLDELLEILKCKEDIGQI--VMTVFYE 107 >At1g17440.2 68414.m02133 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 27.9 bits (59), Expect = 4.7 Identities = 24/79 (30%), Positives = 35/79 (44%) Frame = -1 Query: 464 QNQPGHRRPQLEHRRCLRSLQNQPGHRRPQLEHRGFLRSLQSQPGNRHSQLELRHFLRSL 285 Q Q PQL H+ + Q Q Q + + L QSQ HSQ +L+ + L Sbjct: 402 QQQQQLSSPQL-HQSSMSLNQQQISQIIQQQQQQSQLG--QSQMNQSHSQQQLQQMQQQL 458 Query: 284 QNQQGNRRCQREFQCQKSQ 228 Q Q + Q++ Q Q+ Q Sbjct: 459 QQQPQQQMQQQQQQQQQMQ 477 >At1g17440.1 68414.m02132 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 27.9 bits (59), Expect = 4.7 Identities = 24/79 (30%), Positives = 35/79 (44%) Frame = -1 Query: 464 QNQPGHRRPQLEHRRCLRSLQNQPGHRRPQLEHRGFLRSLQSQPGNRHSQLELRHFLRSL 285 Q Q PQL H+ + Q Q Q + + L QSQ HSQ +L+ + L Sbjct: 402 QQQQQLSSPQL-HQSSMSLNQQQISQIIQQQQQQSQLG--QSQMNQSHSQQQLQQMQQQL 458 Query: 284 QNQQGNRRCQREFQCQKSQ 228 Q Q + Q++ Q Q+ Q Sbjct: 459 QQQPQQQMQQQQQQQQQMQ 477 >At5g63290.1 68418.m07943 coproporphyrinogen oxidase-related low similarity to coproporphyrinogen III oxidase from Geobacillus stearothermophilus [GI:2104798]; contains Pfam profile PF04055: radical SAM domain protein Length = 484 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 487 IDVVYEADRISRDIGVLNWSIDVV 416 + VYEA ++ GV NWS+D++ Sbjct: 210 VSQVYEAIEFVKECGVENWSMDLI 233 >At2g22610.1 68415.m02680 kinesin motor protein-related Length = 1093 Score = 27.5 bits (58), Expect = 6.2 Identities = 18/57 (31%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Frame = +2 Query: 245 EIPVDNVDFPVDSVNFVENVEAP-VENADFPADSVSFVENLDAPVEDA-DVLADSVN 409 ++ +D+ FPVD +N V ++ +P + + DF +D +E D ++D D L DS++ Sbjct: 3 DVQIDDT-FPVD-LNGVTSLCSPEIPSFDFVSDETEKLEIGDTSIDDCDDALGDSMD 57 >At3g53380.1 68416.m05891 lectin protein kinase family protein contains Pfam domains, PF00069: Protein kinase domain, PF00138: Legume lectins alpha domain, and PF00139: Legume lectins beta domain Length = 715 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 60 SHSLERRPPHQSNPSKSRISQYRNTKASTLECTSSPTKSFKNSP 191 ++S++ PP S PS S I NT+ T +S ++ K +P Sbjct: 272 ANSVKSPPPLASQPSSSAIPISSNTQLKTSSSSSCHSRFCKENP 315 >At3g28520.1 68416.m03562 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 478 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Frame = -2 Query: 385 GVLNWSIEVFY---EAYRVSREIGILNWSFDIFYEVYRINREIDV 260 G +++ IE+ Y EA++V + + N S D++ E+ R+ E+DV Sbjct: 368 GRMDYHIEMSYCRFEAFKVLAKNYLENESHDLYGEIGRLLEEVDV 412 >At1g62480.1 68414.m07050 vacuolar calcium-binding protein-related contains weak similarity to vacuolar calcium binding protein [Raphanus sativus] gi|9049359|dbj|BAA99394 Length = 152 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Frame = +2 Query: 191 LAGIELSENVDNVAIFDIEIPVDNVDFPVDSVNFVENVEAPVENADFPADSVS---FVEN 361 +A IE+ E V VA +IE+P + E++ APV + P + + VE Sbjct: 1 MATIEV-EQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEE 59 Query: 362 LDAPVEDAD 388 + P+E+ + Sbjct: 60 TEKPIEETE 68 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,843,381 Number of Sequences: 28952 Number of extensions: 227523 Number of successful extensions: 794 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -