BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i24r (742 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 27 0.80 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 25 1.9 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 24 4.3 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 9.9 AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preprop... 23 9.9 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 26.6 bits (56), Expect = 0.80 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -3 Query: 368 VVSSDFIGDSHSSIFDAAAGISLNDNFVKLISWYDNEYGYSSRVIDLIKYI-QSKD*TLD 192 V +G +HS + + +D VK W + GY ++ L+ I +S D + Sbjct: 168 VAEPQHLGATHSCVSPEPVNLLPDDELVKRAQWLLEKLGYPWEMMPLMYVILKSADGDVQ 227 Query: 191 QMYECKDIFQHVRRDY 144 + ++ D Q V +Y Sbjct: 228 KAHQRIDEGQAVVNEY 243 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 25.4 bits (53), Expect = 1.9 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -3 Query: 350 IGDSHSSIFDAAAGISLNDNFVKLISWYDNEYGYSSRVIDLIKYI-QSKD*TLDQMYECK 174 +G +HS + + +D VK W + GY ++ L+ I +S D + + ++ Sbjct: 150 MGATHSCVSPEPVNLLPDDELVKRAQWLLEKLGYPWEMMPLMYVILKSADGDVQKAHQRI 209 Query: 173 DIFQHVRRDY 144 D Q V +Y Sbjct: 210 DEGQAVVNEY 219 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/51 (23%), Positives = 21/51 (41%) Frame = -3 Query: 368 VVSSDFIGDSHSSIFDAAAGISLNDNFVKLISWYDNEYGYSSRVIDLIKYI 216 V +G +HS + + +D VK W + GY ++ L+ I Sbjct: 168 VAEPQHLGATHSCVSPEPVNLLPDDELVKRAQWLLEKLGYPWEMMPLMYVI 218 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 9.9 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 350 IGDSHSSIFDAAAGISLNDNFVKLISWYDNEYGYSSRVIDLIKYI 216 +G +HS + + +D VK W + GY ++ L+ I Sbjct: 150 MGATHSCVSPEPVNLLPDDELVKRAQWLLEKLGYPWEMMPLMYVI 194 >AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preproprotein protein. Length = 193 Score = 23.0 bits (47), Expect = 9.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 278 SASQSCHSKKFQRQHQRLKSVN 343 S S Q+QHQRLK N Sbjct: 47 STSDEATINHLQQQHQRLKDTN 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,048 Number of Sequences: 2352 Number of extensions: 14286 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -