BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i24r (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 27 0.14 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 27 0.24 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 27 0.24 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 5.3 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 7.0 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 27.5 bits (58), Expect = 0.14 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -3 Query: 305 SLNDNFVKLISWYDNEYGYSSRVIDLIKYIQ 213 SL++N++ IS Y+N+ Y+ ++ I YI+ Sbjct: 84 SLSNNYISNISNYNNDNNYNKKLYYNINYIE 114 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 26.6 bits (56), Expect = 0.24 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -3 Query: 305 SLNDNFVKLISWYDNEYGYSSRVIDLIKYIQ 213 SL++N++ IS Y+N Y+ ++ I YI+ Sbjct: 84 SLSNNYISNISNYNNNNNYNKKLYYNINYIE 114 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 26.6 bits (56), Expect = 0.24 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -3 Query: 305 SLNDNFVKLISWYDNEYGYSSRVIDLIKYIQ 213 SL++N++ IS Y+N Y+ ++ I YI+ Sbjct: 322 SLSNNYISNISNYNNNNNYNKKLYYNINYIE 352 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 5.3 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -2 Query: 588 SCLYWCCQSCG 556 SC WCC + G Sbjct: 10 SCCCWCCDNLG 20 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 7.0 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -2 Query: 576 WCCQSCG*GYPCS 538 + C++CG G+ CS Sbjct: 204 YVCKACGKGFTCS 216 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,694 Number of Sequences: 438 Number of extensions: 3874 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -