BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i24f (630 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF506022-1|AAM46898.1| 685|Tribolium castaneum polyubiquitin pr... 25 0.39 AF506020-1|AAM46896.1| 112|Tribolium castaneum polyubiquitin pr... 25 0.39 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 1.6 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 3.7 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 3.7 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.5 >AF506022-1|AAM46898.1| 685|Tribolium castaneum polyubiquitin protein. Length = 685 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 67 LHLVLRLRGGMQIFVK 82 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 143 LHLVLRLRGGMQIFVK 158 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 219 LHLVLRLRGGMQIFVK 234 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 295 LHLVLRLRGGMQIFVK 310 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 371 LHLVLRLRGGMQIFVK 386 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 447 LHLVLRLRGGMQIFVK 462 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 523 LHLVLRLRGGMQIFVK 538 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 599 LHLVLRLRGGMQIFVK 614 >AF506020-1|AAM46896.1| 112|Tribolium castaneum polyubiquitin protein. Length = 112 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 39 LHLVLRLRGGMQIFVK 54 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 368 SLLVSLPLQIKHLLTWREVLKKLLYQLPVLMPPCLLWV 481 S L L ++KH+L W+ + ++ L LLW+ Sbjct: 109 SKLHKLDNKLKHMLIWKSYKRTQIFITCELFFVILLWI 146 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 471 KHGGISTGS*YNNFFSTSLQVSRCFICSGKD 379 KH I FF S++ +R ++C KD Sbjct: 48 KHYNIFACDGCAGFFKRSIRRNRQYVCKAKD 78 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 471 KHGGISTGS*YNNFFSTSLQVSRCFICSGKD 379 KH I FF S++ +R ++C KD Sbjct: 48 KHYNIFACDGCAGFFKRSIRRNRQYVCKAKD 78 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 8.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 287 LTTRNPS*TSTLPLKRPW 234 LT +PS S P+ +PW Sbjct: 572 LTNWHPSDKSAKPMLKPW 589 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,476 Number of Sequences: 336 Number of extensions: 3328 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -