BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i24f (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) 214 6e-56 SB_4347| Best HMM Match : CXCXC (HMM E-Value=7.9) 33 0.19 SB_10790| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_15451| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.7) 31 1.0 SB_20220| Best HMM Match : E-MAP-115 (HMM E-Value=2.1) 29 4.1 SB_12042| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) 28 5.4 SB_28980| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_28746| Best HMM Match : UPF0193 (HMM E-Value=0.31) 27 9.5 >SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 214 bits (522), Expect = 6e-56 Identities = 97/131 (74%), Positives = 113/131 (86%) Frame = +1 Query: 208 VYLFKYDSTHGRFKGSVEVQDGFLVVNGNKIAVFSERDPKAIPWGKAGAEYVVESTGVFT 387 VY+FKYDSTHGRFKG+VE +DG LV+NG ++VF+ +DP IPWG+ GA+YVVESTGVFT Sbjct: 817 VYMFKYDSTHGRFKGTVEAKDGKLVINGKPVSVFACKDPTQIPWGETGADYVVESTGVFT 876 Query: 388 TTDKASAHLEGGAKKVIISAPSADAPMFVVGVNLEAYDPSFKVISNASCTTNCLAPLAKV 567 T +KA HL+GGAKKVIISAPSADAPMFV+GVN E YDPS V+SNASCTTNCLAPL KV Sbjct: 877 TLEKAGFHLKGGAKKVIISAPSADAPMFVMGVNHEKYDPSMTVVSNASCTTNCLAPLVKV 936 Query: 568 IHDNFEIVEGL 600 I+DNF + EGL Sbjct: 937 INDNFGLEEGL 947 >SB_4347| Best HMM Match : CXCXC (HMM E-Value=7.9) Length = 295 Score = 33.1 bits (72), Expect = 0.19 Identities = 45/150 (30%), Positives = 67/150 (44%) Frame = +2 Query: 140 VLLLKRELKWSL*MTLSSVLTIWFIFSSMIPPMAVLRAVLRFRMDSLLLTVTKLPFSQKG 319 +LLLK L L +TL+ +L + + +L+ L +LLL +T P K Sbjct: 34 ILLLKLTLTPLLKLTLTLLLKLTLTLLLKLALTLLLKLTL-----TLLLKLTLAPLL-KL 87 Query: 320 TLRPFHGEKLGLNML*SLLVSLPLQIKHLLTWREVLKKLLYQLPVLMPPCLLWVLT*KLM 499 TL P KL L L L ++L L++ L + L LL + L +L + Sbjct: 88 TLTPLL--KLTLTPLLKLTLTLLLKLALTLLLKLTLTPLLKLTLTPLLKLTLTLLLKLTL 145 Query: 500 TPLLRSSQMLLAPQTVLPHLQRLFMITLKL 589 TPLL+ + LL T+ P L+ LKL Sbjct: 146 TPLLKLTLTLLLKLTLAPLLKLTLTPLLKL 175 >SB_10790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 31.9 bits (69), Expect = 0.44 Identities = 21/57 (36%), Positives = 31/57 (54%) Frame = +2 Query: 2 LSDFKTPSCTERTWWWSVIQQIFYNLPITCQKLESMDLAALAVWCSVLLLKRELKWS 172 +SD SCT S+ + +FY I+C+KL S+D+ AL + S LL +K S Sbjct: 13 ISDHFMVSCT-----LSLPKTVFYCKEISCRKLRSIDMTALRDYISSSLLHGTMKTS 64 >SB_15451| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.7) Length = 277 Score = 30.7 bits (66), Expect = 1.0 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 446 LPVLMPPCLLWVLT*KLMTPLLRSSQMLL 532 +PV+MP CL + K+M PLL +++LL Sbjct: 194 IPVIMPHCLAAMSCGKVMAPLLAKAELLL 222 >SB_20220| Best HMM Match : E-MAP-115 (HMM E-Value=2.1) Length = 405 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -2 Query: 443 DIITFLAPPSK*ADALSVVVKTPVDSTTYSAPAFPHGMALGSLSE 309 D+I +A P + A A S T V S +Y+ AFP G S S+ Sbjct: 175 DVIERMAAPPRDAPATSTPCPTRVLSPSYALAAFPTGENASSSSQ 219 >SB_12042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 4.1 Identities = 23/82 (28%), Positives = 35/82 (42%) Frame = -1 Query: 372 RLYNIFSPSFSPWNGLRVPF*ENGNFVTVNNKESILNLNTALKTAMGGIILEKINHIVKT 193 R N+ F W GLRV + N V I N T L +I E + VK Sbjct: 6 RAANVTKIPFDGWVGLRVKLKDAANNHEVLVPFLIANQTTDLPIIGFNVIEEIVKGYVKD 65 Query: 192 DERVIYSDHLSSLFNRSTEHQT 127 ++ + S SSL++ +++ T Sbjct: 66 EDNELNSALASSLYDVESDNVT 87 >SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 28.3 bits (60), Expect = 5.4 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 3/117 (2%) Frame = +2 Query: 236 MAVLRAVLRFRMDSLLLTVTKLP-FSQKGTLRPFHGEKLGLNML*SLLVSLPLQIKHLLT 412 +A L+ V+ ++ + L +T L + L P L +L L V +PLQ+ LT Sbjct: 380 LAPLQVVITLQVLTSLQVLTSLQVLTSLQVLTPLQ-VPTPLQVLIPLQVLIPLQV---LT 435 Query: 413 WREVLKKLLYQLP--VLMPPCLLWVLT*KLMTPLLRSSQMLLAPQTVLPHLQRLFMI 577 +VL L LP VL+P +L L + +L Q+L PQ + P LQ L ++ Sbjct: 436 PLQVLIPLQVLLPLQVLIPLQVLTPLQVLITLQVLTPPQVLTPPQVLAP-LQVLILL 491 >SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) Length = 1566 Score = 28.3 bits (60), Expect = 5.4 Identities = 42/163 (25%), Positives = 66/163 (40%), Gaps = 3/163 (1%) Frame = +2 Query: 143 LLLKRELKWSL*MTLSSVLTIWFIFSSMIPPMAVLRAVLRFR--MDSLLLTVTKLPFSQK 316 L+L+ L +T SS LT + P +L +V+ F + L +VT+LP S K Sbjct: 1174 LILETSPYLQLSVTQSSQLTA-SVMHLPFPGKHLLTSVMHFHASVTQLPASVTQLPVSVK 1232 Query: 317 GTLRPFHGEKLGLNML*SLLVSLPLQIKHLLTWREVLKKLLYQLPVLMPPCLLWVLT*KL 496 L + L + + LP+ KHL T L + LP + + V Sbjct: 1233 HLLTSVMHLHASVTHLPASVTQLPVSAKHLPTSVMHLHASVTHLPAFVTQLPVSVKHLPT 1292 Query: 497 MTPLLRSS-QMLLAPQTVLPHLQRLFMITLKLLRXLMTTVHAT 622 L +S L A T LP +++K L + +HA+ Sbjct: 1293 FVMHLHASVTHLPASATQLPASATQLPVSVKHLPTSVMHLHAS 1335 >SB_28980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -2 Query: 155 FSIEARSTKRPMRPNPLIPIFDMLSASYRKFVE*LTTTTYAQYKMEF*NR 6 F+ RSTKRP RP +P+ + + + L + + E+ N+ Sbjct: 9 FAASKRSTKRPRRPQQKMPVLATVQEKFNELQTLLNSLKSSCNNFEYSNK 58 >SB_28746| Best HMM Match : UPF0193 (HMM E-Value=0.31) Length = 927 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -2 Query: 155 FSIEARSTKRPMRPNPLIPIFDMLSASYRKFVE*LTTTTYAQYKMEF*NR 6 F+ RSTKRP RP +P+ + + + L + + E+ N+ Sbjct: 233 FAASKRSTKRPRRPQQKMPVLATVQEKFNELQTLLNSLKSSCNNFEYSNK 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,100,545 Number of Sequences: 59808 Number of extensions: 419480 Number of successful extensions: 990 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -