BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i24f (630 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 25 1.5 AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 25 1.5 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 24 4.6 AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding pr... 24 4.6 AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding pr... 24 4.6 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 8.0 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 8.0 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 8.0 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 8.0 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 67 LHLVLRLRGGMQIFVK 82 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 18 LHLVLSVRGGGQLFNK 65 LHLVL +RGG Q+F K Sbjct: 143 LHLVLRLRGGMQIFVK 158 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 25.4 bits (53), Expect = 1.5 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -1 Query: 309 ENGNFVTVNNKESILNLNTALKTAMGGIILEKINHIVKTDERVIYSDHLSSLFN 148 E + +T+ N + ++ N AL+ G ++N I T + + HL++LFN Sbjct: 138 EGTSNMTMVNCDFLMKWNGALEKRANGKEYYQMNKIKATFDTTRFYMHLTNLFN 191 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 23.8 bits (49), Expect = 4.6 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 532 CTTNCLAPLAKVIHDNFEI-VEGLDD 606 C NCL AKV+ DN ++ +E L D Sbjct: 72 CYMNCLFHEAKVVDDNGDVHLEKLHD 97 >AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding protein AgamOBP1 protein. Length = 144 Score = 23.8 bits (49), Expect = 4.6 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 532 CTTNCLAPLAKVIHDNFEI-VEGLDD 606 C NCL AKV+ DN ++ +E L D Sbjct: 72 CYMNCLFHEAKVVDDNGDVHLEKLHD 97 >AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding protein protein. Length = 144 Score = 23.8 bits (49), Expect = 4.6 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 532 CTTNCLAPLAKVIHDNFEI-VEGLDD 606 C NCL AKV+ DN ++ +E L D Sbjct: 72 CYMNCLFHEAKVVDDNGDVHLEKLHD 97 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.0 bits (47), Expect = 8.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 142 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 231 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 142 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 231 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 142 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 231 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 142 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 231 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 678,958 Number of Sequences: 2352 Number of extensions: 13544 Number of successful extensions: 28 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -