BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i16f (576 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.9 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 8.7 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/38 (26%), Positives = 14/38 (36%) Frame = +3 Query: 462 KKEKVNCDVVSFGEDSENNPLLTTFVNTLNGKDTSTGG 575 KK+ +CD + + PL T V GG Sbjct: 565 KKQPSDCDTLEYRNGEVTTPLFTPAVGVAAASAGGAGG 602 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +3 Query: 414 PVNTDEKELVKLAKRLKKEKVNCDVVSFGEDSENNPL 524 P+N ++ + +K V+ V G EN+PL Sbjct: 200 PLNNNDATPTDFSMGVKNNHVSSKVEGNGVHEENSPL 236 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,502 Number of Sequences: 438 Number of extensions: 3106 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -