BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i14r (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 23 7.2 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 9.6 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/44 (22%), Positives = 24/44 (54%) Frame = +1 Query: 586 KRYVLLLQRSHKLRCVLIVHIIVGVSVHDVEVMTGQLVN*ERDV 717 +RY LL + +R V I+ G ++H++ + T ++ ++ + Sbjct: 142 QRYALLEMKVAIVRMVSFYRILPGDTMHEIRLKTDLVLRPDKSI 185 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 717 DVTLLVDQLAGHDFYIMHGNADDN 646 D+ LLV LAG +Y++ G ++ Sbjct: 24 DIVLLVSLLAGTAWYLLKGKKKES 47 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,810 Number of Sequences: 2352 Number of extensions: 13079 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -