BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i14r (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 22 5.1 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 5.1 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 8.9 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 8.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 8.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 8.9 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 8.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 8.9 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 8.9 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 8.9 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 8.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 8.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 8.9 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.9 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.9 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.9 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.9 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 8.9 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 8.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 8.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 8.9 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 8.9 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 8.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 8.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 8.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 8.9 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 8.9 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 21 8.9 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -2 Query: 693 LAGHDFYIMHGNADDNVHYQNAAKLMRALQEKDI 592 +AGHD + + V + KL++ +E+DI Sbjct: 22 IAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDI 55 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 263 FNGNSNSNLVQLGIFLIPNRTKTVV 337 F N N + GI ++P R + V+ Sbjct: 309 FFANKNQKFYERGIMMLPERWQKVI 333 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 110 IQINATELQKIKLEIHRDLPGK 131 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 110 IQINATELQKIKLEIHRDLPGK 131 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 110 IQINATELQKIKLEIHRDLPGK 131 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 110 IQINATELQKIKLEIHRDLPGK 131 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 110 IQINATELQKIKLEIHRDLPGK 131 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 110 IQINATELQKIKLEIHRDLPGK 131 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 126 IQINATELQKIKLEIHRDLPGK 147 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 16 IQLNATQHQ*LIINLHTDEEAK 81 IQ+NAT+ Q + + +H D K Sbjct: 121 IQINATELQKIKLEIHRDLPGK 142 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 578 ICSKGMSFSCSALISFAA 631 IC++GM SC+ I +A Sbjct: 78 ICAEGMQCSCNKCIGCSA 95 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,286 Number of Sequences: 438 Number of extensions: 3938 Number of successful extensions: 28 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -