BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i14r (724 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24260.1 68418.m02854 prolyl oligopeptidase family protein si... 42 4e-04 >At5g24260.1 68418.m02854 prolyl oligopeptidase family protein similar to dipeptidyl peptidase IV [Stenotrophomonas maltophilia] GI:1753197; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF00930: Dipeptidyl peptidase IV (DPP IV) N-terminal region Length = 746 Score = 41.9 bits (94), Expect = 4e-04 Identities = 16/39 (41%), Positives = 27/39 (69%) Frame = -2 Query: 672 IMHGNADDNVHYQNAAKLMRALQEKDIPFEQMSYPDEAH 556 ++HG D+NVH+++ A+L+ AL E +E + +PDE H Sbjct: 685 LVHGMIDENVHFRHTARLVNALVEAGKRYELLIFPDERH 723 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,975,213 Number of Sequences: 28952 Number of extensions: 264571 Number of successful extensions: 557 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -