BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i11r (503 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 30 0.051 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 5.9 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 29.9 bits (64), Expect = 0.051 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 503 HFRVMYPIFLFAINLFTCLHISVNKYLHENGIV*IIFCPANVKH 372 H RV+ PIF+F + L+ + H +GI+ I FC +K+ Sbjct: 471 HVRVIEPIFIFVMAYLAYLNAEI---FHMSGILAITFCGITMKN 511 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.0 bits (47), Expect = 5.9 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 290 IFHFNWGIWVWFEVGGLCPDCGE 358 I HF+W + + +G C DC + Sbjct: 61 ICHFSWTMEHYHVMGPACRDCAK 83 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 589,074 Number of Sequences: 2352 Number of extensions: 13203 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -