BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i11f (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07210.1 68414.m00767 30S ribosomal protein S18 family contai... 36 0.013 At1g71790.1 68414.m08297 F-actin capping protein beta subunit fa... 30 1.2 At2g47210.1 68415.m05896 myb family transcription factor contain... 29 2.7 At1g52500.1 68414.m05926 formamidopyrimidine-DNA glycolase famil... 27 6.2 At5g26860.1 68418.m03204 Lon protease homolog 2, mitochondrial a... 27 8.3 At5g20790.1 68418.m02470 expressed protein predicted protein, Ar... 27 8.3 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 27 8.3 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 27 8.3 At1g69310.2 68414.m07949 WRKY family transcription factor contai... 27 8.3 At1g69310.1 68414.m07948 WRKY family transcription factor contai... 27 8.3 At1g51940.1 68414.m05855 protein kinase family protein / peptido... 27 8.3 >At1g07210.1 68414.m00767 30S ribosomal protein S18 family contains Pfam profile: PF01084 ribosomal protein S18; similar to 30S ribosomal protein S18 (SP:P80382) {Thermus thermophilus} Length = 261 Score = 36.3 bits (80), Expect = 0.013 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +2 Query: 188 PDAPVEMENPFKKELKQCILCKLNI-DPDYKNYRLLSQFQSPYTGRIYPRHITGLCKRKQ 364 P +M+NP + K + + + + D++N R L+ F + G I R TG+ + Q Sbjct: 148 PRMQKQMQNPRQNNSKSEVTTEEVLKNADFRNVRFLANFITE-AGIIIKRKQTGISAKAQ 206 Query: 365 MQVEQEITKAQDLAYMPYT 421 ++ +EI A+ MP+T Sbjct: 207 RKIAREIKTARAFGLMPFT 225 >At1g71790.1 68414.m08297 F-actin capping protein beta subunit family protein contains Pfam profile: PF01115 F-actin capping protein, beta subunit Length = 256 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/81 (24%), Positives = 36/81 (44%) Frame = +2 Query: 89 MALFKSFFARQMLSTHQAVLSTIRTQSTNLKPDPDAPVEMENPFKKELKQCILCKLNIDP 268 + L + +Q + A+LS I S++L D P+++ + K ILC+ N D Sbjct: 5 LGLLRRMPPKQSETALSALLSLIPQHSSDLLSQVDLPLQVLRDIESG-KDFILCEYNRDA 63 Query: 269 DYKNYRLLSQFQSPYTGRIYP 331 D +++ P +YP Sbjct: 64 DSYRSPWSNKYLPPLEDALYP 84 >At2g47210.1 68415.m05896 myb family transcription factor contains Pfam profile: PF00249 myb DNA-binding domain Length = 441 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +2 Query: 338 ITGLCKRKQMQV-EQEITKAQDLAY--MPYTYKHKIFLKDPKLFDPENPVRSHR 490 +T L +KQ+Q E E + ++ +Y MP T K ++F DP F E P++ + Sbjct: 361 LTLLNLQKQLQYKESEGSSHREGSYAAMPDTPKDRVFAPDPFSFGAERPIKKEQ 414 >At1g52500.1 68414.m05926 formamidopyrimidine-DNA glycolase family protein / mutM, putative (MMH-1) identical to mutM homologue-2 [Arabidopsis thaliana] GP:3550983 PMID:9819050; contains Pfam profile PF01149: Formamidopyrimidine-DNA glycosylase Length = 274 Score = 27.5 bits (58), Expect = 6.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 232 QFFFEWIFHFNWG 194 +F EW+FHF WG Sbjct: 235 EFPVEWLFHFRWG 247 >At5g26860.1 68418.m03204 Lon protease homolog 2, mitochondrial almost identical to Lon protease homolog 2 mitochondrial precursor SP:P93655, GI:1848290 from [Arabidopsis thaliana] Length = 940 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 452 LDLSKIFYVCKCTAYRLNPEPWLFPAPLASVFFYI 348 +DLSK+ +VC + P P L + S+ YI Sbjct: 569 IDLSKVLFVCTANVIDMIPNPLLDRMEVISIAGYI 603 >At5g20790.1 68418.m02470 expressed protein predicted protein, Arabidopsis thaliana Length = 193 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 314 TGRIYPRHITGLCKRKQMQVEQEITKAQDL 403 +GR+ P+ ITG K +V++ +TK + L Sbjct: 71 SGRLEPKSITGPVKETVARVKETVTKTEPL 100 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 27.1 bits (57), Expect = 8.3 Identities = 20/78 (25%), Positives = 30/78 (38%) Frame = +2 Query: 68 SINTYMKMALFKSFFARQMLSTHQAVLSTIRTQSTNLKPDPDAPVEMENPFKKELKQCIL 247 S+ T K F + + H A+ + T D + ENP +K++ Q L Sbjct: 213 SLYTACKSRGFVMISYYDIRAAHAAMRALQNTLLRKRTLDIHFSIPKENPSEKDMNQGTL 272 Query: 248 CKLNIDPDYKNYRLLSQF 301 N+D N LL F Sbjct: 273 VIFNVDTTVSNDELLQLF 290 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 27.1 bits (57), Expect = 8.3 Identities = 20/78 (25%), Positives = 30/78 (38%) Frame = +2 Query: 68 SINTYMKMALFKSFFARQMLSTHQAVLSTIRTQSTNLKPDPDAPVEMENPFKKELKQCIL 247 S+ T K F + + H A+ + T D + ENP +K++ Q L Sbjct: 226 SLYTACKSRGFVMISYYDIRAAHAAMRALQNTLLRKRTLDIHFSIPKENPSEKDMNQGTL 285 Query: 248 CKLNIDPDYKNYRLLSQF 301 N+D N LL F Sbjct: 286 VIFNVDTTVSNDELLQLF 303 >At1g69310.2 68414.m07949 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 287 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/83 (21%), Positives = 34/83 (40%), Gaps = 3/83 (3%) Frame = +2 Query: 161 TQSTNLKPDPDAPVEMENPFKKELKQ---CILCKLNIDPDYKNYRLLSQFQSPYTGRIYP 331 T S P P+ PV+ + +K ++Q + K ++D YR Q +P Sbjct: 107 TASAEKTPPPETPVKEKKKAQKRIRQPRFAFMTKSDVDNLEDGYRWRKYGQKAVKNSPFP 166 Query: 332 RHITGLCKRKQMQVEQEITKAQD 400 R C + V++ + ++ D Sbjct: 167 RSYY-RCTNSRCTVKKRVERSSD 188 >At1g69310.1 68414.m07948 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 287 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/83 (21%), Positives = 34/83 (40%), Gaps = 3/83 (3%) Frame = +2 Query: 161 TQSTNLKPDPDAPVEMENPFKKELKQ---CILCKLNIDPDYKNYRLLSQFQSPYTGRIYP 331 T S P P+ PV+ + +K ++Q + K ++D YR Q +P Sbjct: 107 TASAEKTPPPETPVKEKKKAQKRIRQPRFAFMTKSDVDNLEDGYRWRKYGQKAVKNSPFP 166 Query: 332 RHITGLCKRKQMQVEQEITKAQD 400 R C + V++ + ++ D Sbjct: 167 RSYY-RCTNSRCTVKKRVERSSD 188 >At1g51940.1 68414.m05855 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein contains protein kinases ATP-binding region signature, PROSITE:PS00107 Length = 651 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 209 ENPFKKELKQCILCKLNIDPDYKNYRLLSQFQSPYTGRIYP 331 +NP ++ L +L L PD N L +F P +YP Sbjct: 551 KNPERRPLASIMLAVLKNSPDSMNMSSLKEFVDPNMMDLYP 591 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,918,968 Number of Sequences: 28952 Number of extensions: 254432 Number of successful extensions: 698 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -