BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i10f (559 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 23 1.8 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 9.5 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 9.5 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 9.5 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 9.5 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 190 RRLLRYPRSPVNLDRLNTSLFAELAVFCHAV*PTRP 297 R +L YP++ +N + SL +F H P RP Sbjct: 33 RPMLPYPQNYINSYLFSLSLAQNNQLFTHHKAPIRP 68 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 274 DRTPPTPQRAKYLGDPNSQDS 212 + TPP+PQ Y QD+ Sbjct: 54 EETPPSPQEVYYHHQTIPQDN 74 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -1 Query: 232 DPNSQDSVGTAADAAMPPVC 173 +PN DS+ A++A+ +C Sbjct: 527 EPNMTDSLTRLANSALDNIC 546 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 274 DRTPPTPQRAKYLGDPNSQDS 212 + TPP+PQ Y QD+ Sbjct: 54 EETPPSPQEVYYHHQTIPQDN 74 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 274 DRTPPTPQRAKYLGDPNSQDS 212 + TPP+PQ Y QD+ Sbjct: 54 EETPPSPQEVYYHHQTIPQDN 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,923 Number of Sequences: 336 Number of extensions: 2450 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -