BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i10f (559 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 130 6e-31 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 126 1e-29 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 83 2e-16 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 48 4e-06 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 46 2e-05 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 43 1e-04 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 43 1e-04 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 42 3e-04 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 42 3e-04 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 42 3e-04 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 41 6e-04 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 41 6e-04 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 41 6e-04 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 39 0.003 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 39 0.003 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 38 0.003 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 38 0.003 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 38 0.006 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 37 0.008 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 37 0.010 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 37 0.010 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 36 0.014 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 36 0.018 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 35 0.032 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 35 0.032 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 34 0.056 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 34 0.056 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 34 0.074 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 33 0.098 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 33 0.13 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 33 0.13 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 33 0.17 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 33 0.17 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 31 0.39 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 31 0.39 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 31 0.39 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 31 0.69 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 31 0.69 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 30 1.2 At1g72820.1 68414.m08419 mitochondrial substrate carrier family ... 30 1.2 At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containi... 29 1.6 At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 29 1.6 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 29 1.6 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 29 2.8 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 28 3.7 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 28 3.7 At1g52620.1 68414.m05941 pentatricopeptide (PPR) repeat-containi... 28 3.7 At5g23940.1 68418.m02811 transferase family protein similar to a... 28 4.9 At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transfera... 27 6.4 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 27 6.4 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 27 6.4 At4g15010.3 68417.m02307 mitochondrial substrate carrier family ... 27 8.5 At4g15010.2 68417.m02306 mitochondrial substrate carrier family ... 27 8.5 At4g15010.1 68417.m02305 mitochondrial substrate carrier family ... 27 8.5 At2g40070.1 68415.m04923 expressed protein 27 8.5 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 130 bits (314), Expect = 6e-31 Identities = 62/161 (38%), Positives = 89/161 (55%) Frame = +3 Query: 75 MFSSLLDAARNSPFRGPLSPAQCQSTVAPVAIEQTGGMAASAAVPTESCEFGSPKYFAXX 254 + +L++ N+ F SPA S + I + + AS P + E SP ++A Sbjct: 24 LLDQVLNSNSNAAFEKSPSPAPRSSPTS--MISRKNFLIASPTEPGKGIEMYSPAFYAAC 81 Query: 255 XXXXXXXXXXTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 434 TH V PLDLVKC +Q+D KYK++ +GF + ++E+GV+G +GW PT + Sbjct: 82 TFGGILSCGLTHMTVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGVKGFFRGWVPTLL 141 Query: 435 GYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVYLAAS 557 GYS QG CKFGFYE FK Y+ + E Y+T +YLA S Sbjct: 142 GYSAQGACKFGFYEYFKKTYSDLAGPEYTAKYKTLIYLAGS 182 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 126 bits (304), Expect = 1e-29 Identities = 53/127 (41%), Positives = 78/127 (61%) Frame = +3 Query: 177 TGGMAASAAVPTESCEFGSPKYFAXXXXXXXXXXXXTHTAVVPLDLVKCRLQVDAEKYKN 356 + G + + A P E E SP YFA THTA+ PLD++KC +Q+D KYKN Sbjct: 45 SNGTSFAIATPNEKVEMYSPAYFAACTVAGMLSCGITHTAITPLDVIKCNMQIDPLKYKN 104 Query: 357 VVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRT 536 + + FK +++E+G++G +GW+PT +GYS QG K+G YE K Y+ ++ E A Y+T Sbjct: 105 ITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGLYEYAKKYYSDIVGPEYAAKYKT 164 Query: 537 FVYLAAS 557 +YLA S Sbjct: 165 LIYLAGS 171 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 82.6 bits (195), Expect = 2e-16 Identities = 39/112 (34%), Positives = 60/112 (53%) Frame = +3 Query: 222 EFGSPKYFAXXXXXXXXXXXXTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVR 401 E SP ++ TH A+ PLD++K +QV+ KY ++ +GF +RE G Sbjct: 11 ELSSPWFYTVCTMGGMLSAGTTHLAITPLDVLKVNMQVNPVKYNSIPSGFSTLLREHGHS 70 Query: 402 GLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVYLAAS 557 L +GW+ +GY +QG C+FG YE FK Y+ +L + RT +Y +S Sbjct: 71 YLWRGWSGKLLGYGVQGGCRFGLYEYFKTLYSDVLPNHN----RTSIYFLSS 118 Score = 30.7 bits (66), Expect = 0.69 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 294 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 425 A+ P + +K R+Q K +++GF R EG+ G +G P Sbjct: 128 ALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFP 171 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 48.0 bits (109), Expect = 4e-06 Identities = 26/67 (38%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 +A PLDLV+ RL Y+ V + F+ REEG+ GL KG T +G F Sbjct: 192 SATYPLDLVRTRLSAQRNSIYYQGVGHAFRTICREEGILGLYKGLGATLLGVGPSLAISF 251 Query: 465 GFYEVFK 485 YE FK Sbjct: 252 AAYETFK 258 Score = 32.3 bits (70), Expect = 0.23 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 431 TA PLDLV+ R+Q++ A Y + G FK + EG+RGL +G P + Sbjct: 287 TATFPLDLVRRRMQLEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEY 339 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 46.0 bits (104), Expect = 2e-05 Identities = 24/71 (33%), Positives = 34/71 (47%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 482 PL+LVK RL + YK + + F +REEG L +G AP+ IG + Y+ Sbjct: 224 PLELVKTRLTIQRGVYKGIFDAFLKIIREEGPTELYRGLAPSLIGVVPYAATNYFAYDSL 283 Query: 483 KVAYAGMLDDE 515 + AY E Sbjct: 284 RKAYRSFSKQE 294 Score = 31.5 bits (68), Expect = 0.39 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEK----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 458 TA PL++ + +QV A YKN+++ + EG+ G KG P+ + Sbjct: 314 TATFPLEVARKHMQVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLKLVPAAGI 373 Query: 459 KFGFYEVFK 485 F YE K Sbjct: 374 SFMCYEACK 382 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 43.2 bits (97), Expect = 1e-04 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAE----KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 458 +A P+D+V+ RL V +Y+ + + +REEG R L +GW P+ IG Sbjct: 157 SATYPMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGL 216 Query: 459 KFGFYEVFK 485 F YE K Sbjct: 217 NFSVYESLK 225 Score = 37.5 bits (83), Expect = 0.006 Identities = 26/67 (38%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +3 Query: 285 THTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 455 + TAV PL+ +K LQV KY V G K R EG+RGL KG Sbjct: 52 SRTAVAPLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSA 111 Query: 456 CKFGFYE 476 KF YE Sbjct: 112 VKFFSYE 118 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 43.2 bits (97), Expect = 1e-04 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Frame = +3 Query: 303 PLDLVKCRLQ-----VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 467 P D VK +LQ V +YKN ++ ++ EGV+GL +G +F+G + + FG Sbjct: 34 PFDTVKVKLQKHNTDVQGLRYKNGLHCASRILQTEGVKGLYRGATSSFMGMAFESSLMFG 93 Query: 468 FYEVFKVAYAGMLDDE 515 Y K+ G L D+ Sbjct: 94 IYSQAKLFLRGTLPDD 109 Score = 30.7 bits (66), Expect = 0.69 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +3 Query: 303 PLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 458 P +LVKCR+Q+ +Y + ++ +V+ +GV G+ +G + T + Sbjct: 133 PTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLLRECTGNAV 192 Query: 459 KFGFYEVFKVAYAGMLDD 512 F YE + L+D Sbjct: 193 FFTVYEYLRYHIHSRLED 210 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 41.9 bits (94), Expect = 3e-04 Identities = 30/83 (36%), Positives = 40/83 (48%), Gaps = 6/83 (7%) Frame = +3 Query: 285 THTAVVPLDLVKCRLQVDAEK------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 446 T A+ LD+V+ R QV+ + YKN + R EG+RGL G+ P IG ++ Sbjct: 20 TVAAMHSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTV 79 Query: 447 QGLCKFGFYEVFKVAYAGMLDDE 515 F FY K YA DDE Sbjct: 80 SWGLYFFFYGRAKQRYARGRDDE 102 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 482 PL+++K RL V E Y ++ R +G+RG G PT +G C + Y+ Sbjct: 179 PLEVLKDRLTVSPEIYPSLSLAIPRIFRADGIRGFYAGLGPTLVGMLPYSTCYYFMYDKM 238 Query: 483 KVAY 494 K +Y Sbjct: 239 KTSY 242 Score = 33.5 bits (73), Expect = 0.098 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEKYK---NVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 461 T PL++ + RL V A K + N+ V++EGV GL +GW + + Sbjct: 269 TISFPLEVARKRLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRGWGASCLKVMPSSGIT 328 Query: 462 FGFYEVFK 485 + FYE +K Sbjct: 329 WVFYEAWK 336 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 41.9 bits (94), Expect = 3e-04 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Frame = +3 Query: 285 THTAVVPLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 458 T PLD++K RL V +YK V + K +REEG L KG P + + G Sbjct: 246 TGVLTTPLDVIKTRLMVQGSGTQYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSI 305 Query: 459 KFGFYEVFK 485 FG E K Sbjct: 306 FFGVLEKTK 314 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 40.7 bits (91), Expect = 6e-04 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Frame = +3 Query: 303 PLDLVKCRLQVD-AEKYKNVVN-GFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 P+D++K RLQ+D YK + + G KV VR EGVR L KG P +++ + G Sbjct: 33 PIDVIKTRLQLDRVGAYKGIAHCGSKV-VRTEGVRALWKGLTPFATHLTLKYTLRMGSNA 91 Query: 477 VFKVAY 494 +F+ A+ Sbjct: 92 MFQTAF 97 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +3 Query: 297 VVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 428 V P ++VK RLQ + KYK ++ + VREE + GL G APT Sbjct: 126 VTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPT 175 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +3 Query: 303 PLDLVKCRLQV---DAE---KYKNVVNGFKVSVREEGVRGLAKGWAP 425 P D+VK RL D+E +YK +V+ + EEG+ L +G P Sbjct: 230 PFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLP 276 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 40.7 bits (91), Expect = 6e-04 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 9/70 (12%) Frame = +3 Query: 303 PLDLVKCRL----QVDA---EK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 455 PLDLV+ +L QV A E+ Y+ +V+ F + RE G RGL +G AP+ G Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAG 192 Query: 456 CKFGFYEVFK 485 KF FYE K Sbjct: 193 LKFYFYEEMK 202 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 40.7 bits (91), Expect = 6e-04 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = +3 Query: 303 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 PLD+VK +LQ D K ++ + F+ V+++G RGLA+GW P + ++ + Sbjct: 252 PLDVVKTQLQCQGVCGCDRFKSSSISDVFRTIVKKDGYRGLARGWLPRMLFHAPAAAICW 311 Query: 465 GFYEVFK 485 YE K Sbjct: 312 STYETVK 318 Score = 33.9 bits (74), Expect = 0.074 Identities = 25/95 (26%), Positives = 35/95 (36%) Frame = +3 Query: 228 GSPKYFAXXXXXXXXXXXXTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGL 407 G+P A + P+D+VK RLQ+ YK V + K REEG Sbjct: 127 GNPNNSAAHAISGVFATISSDAVFTPMDMVKQRLQIGNGTYKGVWDCIKRVTREEGFGAF 186 Query: 408 AKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDD 512 + T + + F YE K ML + Sbjct: 187 YASYRTTVLMNAPFTAVHFTTYEAVKRGLREMLPE 221 Score = 28.3 bits (60), Expect = 3.7 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 3/74 (4%) Frame = +3 Query: 288 HTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 458 H A+ P+D VK +Q K + F+ ++ +G L +G +G Sbjct: 53 HMAMFPVDTVKTHMQALRSCPIKPIGIRQAFRSIIKTDGPSALYRGIWAMGLGAGPAHAV 112 Query: 459 KFGFYEVFKVAYAG 500 F FYEV K +G Sbjct: 113 YFSFYEVSKKFLSG 126 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 38.7 bits (86), Expect = 0.003 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = +3 Query: 285 THTAVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 449 T A PL +VK RLQ + YK+ + + EEG+RGL G P G S Sbjct: 127 TTIATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHV 186 Query: 450 GLCKFGFYEVFKVAYA 497 + +F YE+ KV A Sbjct: 187 AI-QFPTYEMIKVYLA 201 Score = 34.3 bits (75), Expect = 0.056 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +3 Query: 291 TAVVPLDLVKCRLQV-------DAE-KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 446 T V PLD++K R QV DA K +V + + EG+RGL +G +PT + Sbjct: 29 TFVCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLS 88 Query: 447 QGLCKFGFYEVFK 485 F Y+ K Sbjct: 89 NWAIYFTMYDQLK 101 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 38.7 bits (86), Expect = 0.003 Identities = 29/78 (37%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Frame = +3 Query: 285 THTAVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 449 T A PL +VK RL + YK+V++ F EEGVRGL G P+ G S Sbjct: 131 TSIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHV 190 Query: 450 GLCKFGFYEVFKVAYAGM 503 + +F YE K A M Sbjct: 191 AI-QFPAYEKIKQYMAKM 207 Score = 37.1 bits (82), Expect = 0.008 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +3 Query: 291 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 446 T V PLD++K RLQV ++ ++ K ++EEG RG+ +G +PT I Sbjct: 33 TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLP 92 Query: 447 QGLCKFGFYEVFK 485 F Y K Sbjct: 93 NWAVYFSVYGKLK 105 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 6/78 (7%) Frame = +3 Query: 303 PLDLVKCRLQVDAE------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 P ++++ +LQ + KY V++ R EG+ GL +G A + + + F Sbjct: 237 PHEVIRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITF 296 Query: 465 GFYEVFKVAYAGMLDDET 518 YE+ + ++ ET Sbjct: 297 TTYEMMLRFFRQVVPPET 314 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 482 PLD ++ ++Q+ YK+V++ F + EGV GL +G+ P + K +++ Sbjct: 325 PLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIV 384 Query: 483 K 485 K Sbjct: 385 K 385 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 38.3 bits (85), Expect = 0.003 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 9/76 (11%) Frame = +3 Query: 300 VPLDLVKCRLQ---------VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 452 +PLD K RLQ V KY+ ++ REEG+R L KG P + G Sbjct: 30 IPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLFG 89 Query: 453 LCKFGFYEVFKVAYAG 500 + G YE K Y G Sbjct: 90 GLRIGMYEPVKNLYVG 105 Score = 35.9 bits (79), Expect = 0.018 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Frame = +3 Query: 303 PLDLVKCRLQVDAE-------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 461 P DLVK RLQ + + +Y +N + VR+EGVR L G P ++ + Sbjct: 134 PTDLVKVRLQAEGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAE 193 Query: 462 FGFYEVFK 485 Y+ K Sbjct: 194 LASYDQVK 201 Score = 35.1 bits (77), Expect = 0.032 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 431 P+D+VK R+ D+ YK ++ F +++ +G KG+ P F Sbjct: 234 PVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNF 276 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 37.5 bits (83), Expect = 0.006 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +3 Query: 297 VVPLDLVKCRLQVDAEK---YKNVVNGFKVSVREEGVRGLAKGWAP 425 V P D+VK LQVD K Y ++ F+ ++ EGV+GL KG+ P Sbjct: 231 VYPTDVVKSVLQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGP 276 Score = 33.9 bits (74), Expect = 0.074 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 15/84 (17%) Frame = +3 Query: 303 PLDLVKCRLQ--------------VDAEKYKNVVNGFKVSVREEG-VRGLAKGWAPTFIG 437 P +L+KCRLQ V A KY ++ + +R EG RGL KG PTF Sbjct: 124 PTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPTFAR 183 Query: 438 YSMQGLCKFGFYEVFKVAYAGMLD 509 F YE FK AG D Sbjct: 184 EVPGNATMFAAYEAFKRFLAGGSD 207 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 37.1 bits (82), Expect = 0.008 Identities = 22/79 (27%), Positives = 38/79 (48%) Frame = +3 Query: 285 THTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 + TA PLD +K LQ+ + + K+ ++ GVRG +G + + + KF Sbjct: 222 SRTATAPLDRLKVLLQIQKTDAR-IREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKF 280 Query: 465 GFYEVFKVAYAGMLDDETA 521 YE+FK A + ++ A Sbjct: 281 YAYELFKNAIGENMGEDKA 299 Score = 36.7 bits (81), Expect = 0.010 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEKYKNVVNG-FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 467 T V PL +V+ R+Q AE+ + ++G F+ ++ EEG R L KG P + + Sbjct: 418 TCVYPLQVVRTRMQ--AERARTSMSGVFRRTISEEGYRALYKGLLPNLLKVVPAASITYM 475 Query: 468 FYEVFK 485 YE K Sbjct: 476 VYEAMK 481 Score = 27.5 bits (58), Expect = 6.4 Identities = 20/68 (29%), Positives = 27/68 (39%), Gaps = 4/68 (5%) Frame = +3 Query: 294 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVRE----EGVRGLAKGWAPTFIGYSMQGLCK 461 ++ PLDLVK RLQ + V ++ EG R KG P+ +G Sbjct: 320 SIYPLDLVKTRLQTYTSQAGVAVPRLGTLTKDILVHEGPRAFYKGLFPSLLGIIPYAGID 379 Query: 462 FGFYEVFK 485 YE K Sbjct: 380 LAAYETLK 387 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 36.7 bits (81), Expect = 0.010 Identities = 23/103 (22%), Positives = 48/103 (46%), Gaps = 9/103 (8%) Frame = +3 Query: 228 GSPKYFAXXXXXXXXXXXXTHTAVVPLDLVKCRLQVDAEK--------YKNVVNGFKVSV 383 G K+FA T + LD + RL DA++ +K +++ ++ ++ Sbjct: 110 GYLKWFAGNVASGSAAGATTSLFLYHLDYARTRLGTDAKECSVNGKRQFKGMIDVYRKTL 169 Query: 384 REEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK-VAYAGMLD 509 +G++GL +G+ + +G ++ FG Y+ K + G L+ Sbjct: 170 SSDGIKGLYRGFGVSIVGITLYRGMYFGMYDTIKPIVLVGSLE 212 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 36.7 bits (81), Expect = 0.010 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +3 Query: 303 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 P DL++ L Q + + Y N+ + F V+ G++GL G +PT I +FG Y+ Sbjct: 146 PFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTYD 205 Query: 477 VFK 485 FK Sbjct: 206 TFK 208 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 36.3 bits (80), Expect = 0.014 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +3 Query: 300 VPLDLVKCRLQV-DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 +PLD ++ +L E + F+ ++ EG+ L KG P+ ++ G +G Y+ Sbjct: 160 LPLDTIRTKLVARGGEALGGIGGAFRYMIQTEGLFSLYKGLVPSIASMALSGAVFYGVYD 219 Query: 477 VFKVAY 494 + K ++ Sbjct: 220 ILKSSF 225 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.9 bits (79), Expect = 0.018 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 431 P+D+VK R+ D+ Y+N V+ F +++ EG+ KG+ P F Sbjct: 236 PIDVVKSRMMGDST-YRNTVDCFIKTMKTEGIMAFYKGFLPNF 277 Score = 34.3 bits (75), Expect = 0.056 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +3 Query: 300 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 449 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 450 GLCKFGFYEVFKVAYAG 500 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 35.1 bits (77), Expect = 0.032 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 303 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 P DL++ L Q + + Y + + F ++ G+RGL G PT + +FG Y+ Sbjct: 151 PFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYD 210 Query: 477 VFK 485 +FK Sbjct: 211 MFK 213 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 339 AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 434 A KY +V K REEG RG +G P + Sbjct: 66 ASKYTGMVQATKDIFREEGFRGFWRGNVPALL 97 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 35.1 bits (77), Expect = 0.032 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +3 Query: 294 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 473 A PLD+VK RLQ Y+ + + F+ SV++EG L +G + F Y Sbjct: 217 ACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFAAY 276 Query: 474 EV 479 EV Sbjct: 277 EV 278 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 34.3 bits (75), Expect = 0.056 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 470 + V PL +++ R+Q D+ K ++ F ++R EG++G +G P F + Sbjct: 409 SCVYPLQVIRTRMQADSSK-TSMGQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLV 467 Query: 471 YEVFK 485 YE K Sbjct: 468 YEAMK 472 Score = 31.1 bits (67), Expect = 0.52 Identities = 22/72 (30%), Positives = 30/72 (41%) Frame = +3 Query: 285 THTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 + TA PLD +K LQV VV K RE+ + G +G + + KF Sbjct: 218 SRTATAPLDRLKVALQVQRTNL-GVVPTIKKIWREDKLLGFFRGNGLNVAKVAPESAIKF 276 Query: 465 GFYEVFKVAYAG 500 YE+ K G Sbjct: 277 AAYEMLKPIIGG 288 Score = 29.1 bits (62), Expect = 2.1 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +3 Query: 291 TAVVPLDLVKCRLQ--VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 TA+ P+DLVK RLQ V + K +EG R +G P+ IG Sbjct: 311 TAIYPMDLVKTRLQTFVSEVGTPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIPYAGIDL 370 Query: 465 GFYEVFK 485 YE K Sbjct: 371 AAYETLK 377 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 34.3 bits (75), Expect = 0.056 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +3 Query: 300 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 449 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 450 GLCKFGFYEVFKVAYAG 500 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 33.9 bits (74), Expect = 0.074 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 482 P+D+VK RLQ+ YK V + K +REEG+ + T + + F YE Sbjct: 150 PMDMVKQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVLMNAPFTAVHFATYEAA 209 Query: 483 K 485 K Sbjct: 210 K 210 Score = 33.5 bits (73), Expect = 0.098 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%) Frame = +3 Query: 303 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 PLD+VK +LQ D ++ + + V+++G RGL +GW P + ++ + Sbjct: 247 PLDVVKTQLQCQGVCGCDRFTSSSISHVLRTIVKKDGYRGLLRGWLPRMLFHAPAAAICW 306 Query: 465 GFYEVFKVAYAGM-LDDETA 521 YE K + +D TA Sbjct: 307 STYEGVKSFFQDFNVDSNTA 326 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = +3 Query: 288 HTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 458 H A+ P+D +K +Q K + F+ +++EG L +G +G Sbjct: 51 HMAMFPVDTIKTHMQALRPCPLKPVGIREAFRSIIQKEGPSALYRGIWAMGLGAGPAHAV 110 Query: 459 KFGFYEVFK 485 F FYEV K Sbjct: 111 YFSFYEVSK 119 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 33.5 bits (73), Expect = 0.098 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +3 Query: 303 PLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 440 PLD+VK RLQV KYK ++ R+EG +G +G P + Y Sbjct: 271 PLDVVKTRLQVQGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWY 318 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/65 (27%), Positives = 31/65 (47%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 470 + V PL +V+ R+Q D+ K + F +++ EG+RG +G P + + Sbjct: 410 SCVYPLQVVRTRMQADSSK-TTMKQEFMNTMKGEGLRGFYRGLLPNLLKVVPAASITYIV 468 Query: 471 YEVFK 485 YE K Sbjct: 469 YEAMK 473 Score = 30.7 bits (66), Expect = 0.69 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 3/68 (4%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVR---EEGVRGLAKGWAPTFIGYSMQGLCK 461 TA+ P+DLVK RLQ + +K++ EG R KG P+ +G Sbjct: 312 TAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIVPYAGID 371 Query: 462 FGFYEVFK 485 YE K Sbjct: 372 LAAYETLK 379 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 33.1 bits (72), Expect = 0.13 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNG----FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 470 PLD+VK RLQ+ + + G F ++ EG R L G P + G + G Sbjct: 83 PLDVVKVRLQMQHVGQRGPLIGMTGIFLQLMKNEGRRSLYLGLTPALTRSVLYGGLRLGL 142 Query: 471 YEVFKVAY 494 YE KV++ Sbjct: 143 YEPTKVSF 150 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 32.7 bits (71), Expect = 0.17 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%) Frame = +3 Query: 303 PLDLVKCRLQV--DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 PLD +K RLQV E + K + E+G +G +G P F S G YE Sbjct: 254 PLDTIKTRLQVMGHQENRPSAKQVVKKLLAEDGWKGFYRGLGPRFFSMSAWGTSMILTYE 313 Query: 477 VFK 485 K Sbjct: 314 YLK 316 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +3 Query: 303 PLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 P D+VK R+ E Y+N + +V+ EG+R L KG+ PT+ + YE Sbjct: 235 PADVVKTRMMNQGENAVYRNSYDCLVKTVKFEGIRALWKGFFPTWARLGPWQFVFWVSYE 294 Query: 477 VFKV 488 F++ Sbjct: 295 KFRL 298 Score = 31.5 bits (68), Expect = 0.39 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 8/49 (16%) Frame = +3 Query: 303 PLDLVKCRLQVDAE--------KYKNVVNGFKVSVREEGVRGLAKGWAP 425 P DLVK R+Q D +Y + F ++ EGV+GL KG P Sbjct: 134 PADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLP 182 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 31.5 bits (68), Expect = 0.39 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 425 PLD V+ ++Q+ YK++ F + +G+ GL +G+ P Sbjct: 297 PLDTVRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLP 337 Score = 29.1 bits (62), Expect = 2.1 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 8/83 (9%) Frame = +3 Query: 291 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 446 T PLD +K +Q A+K + + +EEGV+G KG P I Sbjct: 103 TVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVLP 162 Query: 447 QGLCKFGFYEVFKVAYAGMLDDE 515 + YE +K + G DD+ Sbjct: 163 YSAVQLLAYESYKNLFKGK-DDQ 184 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 31.5 bits (68), Expect = 0.39 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 6/53 (11%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 431 TA PLDLV+ R+QV+ A Y + G FK + EG +G+ +G P + Sbjct: 259 TATYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEY 311 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 31.5 bits (68), Expect = 0.39 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNGFKVSV-REEGVRGLAKGWAPTFIGYSMQGLCKFGFYEV 479 P D++K R+ ++ VS+ R EG GL KG P F + G F YE+ Sbjct: 741 PFDVMKTRMMTATPGRPISMSMVVVSILRNEGPLGLFKGAVPRFFWVAPLGAMNFAGYEL 800 Query: 480 FKVA 491 K A Sbjct: 801 AKKA 804 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 30.7 bits (66), Expect = 0.69 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +3 Query: 294 AVVPLDLVKCRLQV---DAEKYKNVVNGFKVSVREEGVRGLAKG 416 A P+D V+ R+ + +A KYK+ + F V++EG + L KG Sbjct: 307 ASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKG 350 Score = 29.9 bits (64), Expect = 1.2 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 443 TA P++ VK +Q E YK + + F ++R+EG+ L +G I Y Sbjct: 100 TAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYF 159 Query: 444 MQGLCKFGFYEVFK 485 F F + FK Sbjct: 160 PTQALNFAFKDYFK 173 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 30.7 bits (66), Expect = 0.69 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 348 YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 485 Y + ++ +E G RGL +G PT IG KF YE K Sbjct: 171 YSGIKEVLAMAYKEGGPRGLYRGIGPTLIGILPYAGLKFYIYEELK 216 Score = 27.5 bits (58), Expect = 6.4 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEKYK--NVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 TAV PL+ +K LQ +K V K ++ +G G KG + I + Sbjct: 39 TAVAPLERIKILLQTRTNDFKTLGVSQSLKKVLQFDGPLGFYKGNGASVIRIIPYAALHY 98 Query: 465 GFYEVFK 485 YEV++ Sbjct: 99 MTYEVYR 105 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 434 T +P +++K RLQ A ++ N+V + +EG++GL +G T + Sbjct: 133 TLRIPCEVLKQRLQ--ANQFDNIVEATVSTWHQEGLKGLFRGTGVTLL 178 >At1g72820.1 68414.m08419 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 349 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +3 Query: 294 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 437 A+ P L+K R QV + + F + VR EG+RGL +G+ + +G Sbjct: 44 ALYPAVLMKTRQQVCHSQGSCIKTAFTL-VRHEGLRGLYRGFGTSLMG 90 >At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 730 Score = 29.5 bits (63), Expect = 1.6 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 7/57 (12%) Frame = +3 Query: 336 DAEKYKNVVNGF----KVSVREEGV-RGLAKGWAPTFI--GYSMQGLCKFGFYEVFK 485 DAE + +V+ G +++ + V R L +G+AP I GY M GLCK G + K Sbjct: 286 DAETFNDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAK 342 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 29.5 bits (63), Expect = 1.6 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 9/74 (12%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 443 TA P++ VK +Q +E YK + + F +V++EG+ L +G I Y Sbjct: 95 TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNTANVIRYF 154 Query: 444 MQGLCKFGFYEVFK 485 F F + FK Sbjct: 155 PTQALNFAFKDYFK 168 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 381 VREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 485 +REEG+R L G + T + ++ + G Y++ K Sbjct: 72 IREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIK 106 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 303 PLDLVKCRLQ-VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 428 P+D+VK R+ D E Y ++ V EEG L KG PT Sbjct: 268 PIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPT 310 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = +3 Query: 297 VVPLDLVKCRLQVD-----AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 461 V PLD+ RL D A +++ + + +++GVRG+ +G + G + Sbjct: 159 VYPLDIAHTRLAADIGKPEARQFRGIHHFLSTIHKKDGVRGIYRGLPASLHGVIIHRGLY 218 Query: 462 FGFYEVFKVAYA 497 FG ++ K ++ Sbjct: 219 FGGFDTVKEIFS 230 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 28.3 bits (60), Expect = 3.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -1 Query: 277 HDRTPPTPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDW 143 H + P PQ + D N+ + + A+ A+ S ATG VDW Sbjct: 151 HQQQNPNPQHQQR--DANNPAGLLSIAEEALAEFLSKATGTAVDW 193 >At1g52620.1 68414.m05941 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 819 Score = 28.3 bits (60), Expect = 3.7 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Frame = +3 Query: 357 VVNGFKVSVREEGVRGLAKGWAPTFIGYSM--QGLCKFGFYEVFKVAYAGMLDDE---TA 521 VV+G V+ + +G +P Y+M GLCK G + K+ ++ MLD A Sbjct: 426 VVSGHMDDAVNMKVKLIDRGVSPDAAIYNMLMSGLCKTGRFLPAKLLFSEMLDRNILPDA 485 Query: 522 YTYRTFV 542 Y Y T + Sbjct: 486 YVYATLI 492 >At5g23940.1 68418.m02811 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 484 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 382 TDTLKPFTTFLYFSASTWRRHFTRSRG 302 +D+ KPF+TF ++ W RH T +RG Sbjct: 263 SDSSKPFSTFQSLTSHIW-RHVTLARG 288 >At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 27.5 bits (58), Expect = 6.4 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +3 Query: 324 RLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 464 R + EK + + GF+ V+ +G+ + +GWAP + Q C F Sbjct: 325 RKNIGIEKEEWLPEGFEERVKGKGM--IIRGWAPQVLILDHQATCGF 369 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 27.5 bits (58), Expect = 6.4 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 443 TA P++ VK +Q +E YK + + F ++++EG L +G I Y Sbjct: 96 TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYF 155 Query: 444 MQGLCKFGFYEVFK 485 F F + FK Sbjct: 156 PTQALNFAFKDYFK 169 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 27.5 bits (58), Expect = 6.4 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = +3 Query: 291 TAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 443 TA P++ VK +Q +E YK + + F ++++EG L +G I Y Sbjct: 96 TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYF 155 Query: 444 MQGLCKFGFYEVFK 485 F F + FK Sbjct: 156 PTQALNFAFKDYFK 169 >At4g15010.3 68417.m02307 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.1 bits (57), Expect = 8.5 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 477 VFKVAY 494 + Y Sbjct: 90 ILTAFY 95 >At4g15010.2 68417.m02306 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.1 bits (57), Expect = 8.5 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 477 VFKVAY 494 + Y Sbjct: 90 ILTAFY 95 >At4g15010.1 68417.m02305 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.1 bits (57), Expect = 8.5 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +3 Query: 303 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 476 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 477 VFKVAY 494 + Y Sbjct: 90 ILTAFY 95 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 27.1 bits (57), Expect = 8.5 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 8/83 (9%) Frame = -1 Query: 415 PLARPRTPSSRTDTL-------KPFT-TFLYFSASTWRRHFTRSRGTTAVWVRPHDRTPP 260 P +RP TP+ R+ TL +P T T +S R T SR T + +P + Sbjct: 182 PGSRPATPTGRSSTLTANSKSSRPSTPTSRATVSSATRPSLTNSRSTVSATTKPTPMSRS 241 Query: 259 TPQRAKYLGDPNSQDSVGTAADA 191 T + L S+ + TA A Sbjct: 242 TSLSSSRLTPTASKPTTSTARSA 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,681,249 Number of Sequences: 28952 Number of extensions: 230205 Number of successful extensions: 770 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -