BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i08r (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 2.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 6.6 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 6.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.7 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -3 Query: 199 IRYLENNNSFLSHMRCIRVHKNSVLNYYIEQANYYFCIV 83 I + NN L + I++ K N Y Q N Y IV Sbjct: 338 IEIVAKNNDTLQFISGIKIIKQISSNIYERQNNEYIWIV 376 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -3 Query: 523 WWNHFICEYEHPSYT--NCHTSRYC 455 W +HF C Y + S T N + +++C Sbjct: 430 WEHHFQCRYPNASVTPYNKNYTKFC 454 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 248 VSILIPNAKFSIYNTYYYYIN 310 +S L N K+S YN Y Y N Sbjct: 315 ISSLSNNYKYSNYNNYNNYNN 335 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 121 NLIQNFCVP*YTAYGSGMN 177 NL++ +P +T+Y SG+N Sbjct: 432 NLLEKNWLPVHTSYKSGLN 450 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -3 Query: 511 FICEYEHPSYTNCHTSRYCYFFTC 440 F+C YE + CH C F C Sbjct: 735 FLCRYEAHCFALCHC---CDFDAC 755 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,902 Number of Sequences: 438 Number of extensions: 4142 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -