BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i08f (599 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB065958-1|BAC06171.1| 311|Homo sapiens seven transmembrane hel... 35 0.19 AL606804-8|CAI17152.1| 308|Homo sapiens olfactory receptor, fam... 30 5.4 AB065440-1|BAC05707.1| 308|Homo sapiens seven transmembrane hel... 30 5.4 >AB065958-1|BAC06171.1| 311|Homo sapiens seven transmembrane helix receptor protein. Length = 311 Score = 35.1 bits (77), Expect = 0.19 Identities = 18/61 (29%), Positives = 33/61 (54%) Frame = -3 Query: 504 DVIFFIFQCTLVIIPGQIILKSCLFVLALFIVRHFTRVWYSEGKSPALSMTHKQIQQVNM 325 +++ IF +++P IL S +F++A + R+ Y+EG+S A S I V++ Sbjct: 196 ELLILIFSGINILVPSLTILSSYIFIIASIL-----RIRYTEGRSKAFSTCSSHISAVSV 250 Query: 324 F 322 F Sbjct: 251 F 251 >AL606804-8|CAI17152.1| 308|Homo sapiens olfactory receptor, family 5, subfamily AV, member 1 pseudogene protein. Length = 308 Score = 30.3 bits (65), Expect = 5.4 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = -3 Query: 555 CTIS*VF*VLESKSISFDVIFFIFQCTLVIIPGQIILKSCLFVLALFIVRHFTRVWYSEG 376 C I + +L+ K I+ ++ +F +LVII +I S +++ ++ + R+ EG Sbjct: 180 CNIPQLLSLLDPKVITIEIGVMVFGTSLVIISFVVITLSYMYIFSVIM-----RIPSKEG 234 Query: 375 KSPALSMTHKQIQQVNMFR-THSCGVVKP 292 +S S + V +F + S VKP Sbjct: 235 RSKTFSTCIPHLVVVTLFMISGSIAYVKP 263 >AB065440-1|BAC05707.1| 308|Homo sapiens seven transmembrane helix receptor protein. Length = 308 Score = 30.3 bits (65), Expect = 5.4 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = -3 Query: 555 CTIS*VF*VLESKSISFDVIFFIFQCTLVIIPGQIILKSCLFVLALFIVRHFTRVWYSEG 376 C I + +L+ K I+ ++ +F +LVII +I S +++ ++ + R+ EG Sbjct: 180 CNIPQLLSLLDPKVITIEIGVMVFGTSLVIISFVVITLSYMYIFSVIM-----RIPSKEG 234 Query: 375 KSPALSMTHKQIQQVNMFR-THSCGVVKP 292 +S S + V +F + S VKP Sbjct: 235 RSKTFSTCIPHLVVVTLFMISGSIAYVKP 263 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,080,227 Number of Sequences: 237096 Number of extensions: 1730881 Number of successful extensions: 3032 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3032 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -