BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i07r (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 23 2.4 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 4.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.6 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 543 NCTRMSALSTVYKH-GRAYFSQTFFFFLHIN 632 N T + AL T ++ GR S+ +FF LH++ Sbjct: 53 NSTVLLALWTRRRYAGRKKLSRMYFFILHLS 83 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 397 FTTKIMSNNKNNNHMIT 447 FT KI NN NN M T Sbjct: 482 FTYKITVNNSGNNRMGT 498 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 388 TSVIFFCKFNNMVLSVRHHFISFSCKFYYV 299 +S+ FFC +++ H F+C Y V Sbjct: 977 SSLFFFCMAAEFIIAALLHPQEFNCLKYGV 1006 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 388 TSVIFFCKFNNMVLSVRHHFISFSCKFYYV 299 +S+ FFC +++ H F+C Y V Sbjct: 977 SSLFFFCMAAEFIIAALLHPQEFNCLKYGV 1006 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 211 CSKNKISETVYEKLNGEIKKIFV*NC 134 C K+ + +T+ +L G I V NC Sbjct: 2674 CGKHPLLKTLNNELRGTPSDISVTNC 2699 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,240 Number of Sequences: 336 Number of extensions: 3294 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -