BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i07r (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_42101| Best HMM Match : Tryp_alpha_amyl (HMM E-Value=3.6) 28 6.3 SB_36759| Best HMM Match : Tryp_alpha_amyl (HMM E-Value=3.6) 28 6.3 >SB_57393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 568 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 370 CKFNNMVLSVRHHFISFSCKFYYVSSLTI 284 CK+NN V R F++F+ Y++ S+ + Sbjct: 335 CKYNNAVAVYRVMFLTFNLVVYFIPSIAL 363 >SB_42101| Best HMM Match : Tryp_alpha_amyl (HMM E-Value=3.6) Length = 307 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 654 KFDCVAIHLYVEKKKMSEKSTHAHVYIPLIVRTFVC 547 +F C+AI LY ++ + H+Y +++ F C Sbjct: 72 RFHCIAISLYRGSTVLTYRYIEVHLYCRIVISRFHC 107 >SB_36759| Best HMM Match : Tryp_alpha_amyl (HMM E-Value=3.6) Length = 357 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 654 KFDCVAIHLYVEKKKMSEKSTHAHVYIPLIVRTFVC 547 +F C+AI LY ++ + H+Y +++ F C Sbjct: 76 RFHCIAISLYRGSTVLTYRYIEVHLYCRIVISRFHC 111 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,035,397 Number of Sequences: 59808 Number of extensions: 338219 Number of successful extensions: 734 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -