BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11i06r (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 27 0.80 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 26 1.1 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 26 1.4 AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine p... 25 1.8 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 25 3.2 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 25 3.2 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 24 4.3 AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. 24 4.3 AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. 24 4.3 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 24 5.6 AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine p... 23 7.4 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 7.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 7.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 7.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 7.4 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 23 7.4 DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor... 23 9.8 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 23 9.8 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine p... 23 9.8 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 9.8 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 9.8 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 26.6 bits (56), Expect = 0.80 Identities = 19/72 (26%), Positives = 29/72 (40%) Frame = +3 Query: 432 RPALPTT*APKLKPIRCTWFQLPPALLMSQTKKLPRARPTSGTPAAAVL*FELASLCQST 611 RP P P + P R W PP + P RPT+ T A + +++ Sbjct: 78 RPGRPWWSVPGIPPFRPPWHPRPPFGGRPWWLRPPFHRPTTSTAAPEGTSVASPTTAEAS 137 Query: 612 TMTFTS*TARKA 647 T T + T ++A Sbjct: 138 TTTEAATTTQEA 149 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 598 RLANSNYNTAAAGVPDVGRALGNFLVWL 515 R +S+Y AA G+ D +G F+ WL Sbjct: 151 RKLSSSYYLAALGLSDTFYLIGQFVAWL 178 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -1 Query: 141 TSGKPSFPTAMVELCIWATETLGSADPAST 52 ++ + SF T +E +W T+ +GS+ A+T Sbjct: 112 SNSQASFRTNFLESWLWKTDKIGSSGSATT 141 >AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +2 Query: 329 DVMTSIAVECVRVSSPLWSGGVQTCNACGATTGLASGITNDVS 457 D++ C++ +T N ATTG A+ ITN+ + Sbjct: 5 DIIKKCVSHCLQYILTEGPPAKKTSNTANATTGAANAITNNAT 47 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 715 GTVVIVHGWNNNGN-TQMNPLIRSAFLAVQD 626 GT+ IV GW + N + N ++R+A + D Sbjct: 158 GTMTIVSGWGSTHNAAESNAILRAANVPTVD 188 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 589 NSNYNTAAAGVPDVGRALGNFLVWL 515 +S+Y AA G+ D +G F+ WL Sbjct: 73 SSSYYLAALGISDTCYLVGLFVTWL 97 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 24.2 bits (50), Expect = 4.3 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = -3 Query: 535 GNFLVWLINNAGGNWNQVHLIGFSLGAHVVGNAGRQAGGRPARVTGLDPAGPQ 377 G +WL NNA + V + F G + G++G G P G GPQ Sbjct: 277 GQVRLWLTNNAPASKLIVSIPTFGRGWKMNGDSG-ITGVPPLPADGPSNPGPQ 328 >AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 144 VTSGKPSFPTAMVELCIWATETLGSADPAST 52 +++ + SF T +E +W T+ +GS+ +T Sbjct: 111 LSNSQVSFRTNFLESWLWKTDKIGSSGSTTT 141 >AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 144 VTSGKPSFPTAMVELCIWATETLGSADPAST 52 +++ + SF T +E +W T+ +GS+ +T Sbjct: 111 LSNSQVSFRTNFLESWLWKTDKIGSSGSTTT 141 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 5.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG AS +TN+ + Sbjct: 27 KTSSTANATTGAASAVTNNAT 47 >AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 7.4 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +2 Query: 329 DVMTSIAVECVRVSSPLWSGGVQTCNACGATTGLASGITNDVS 457 D++ C++ +T + ATTG A+ ITN+ + Sbjct: 5 DIIKKCVSHCLQYILTEGPPAKKTSSTANATTGAANAITNNAT 47 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.4 bits (48), Expect = 7.4 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = -3 Query: 334 YVECIHTDGRALGIFNPSGDADFYPNGGRNPQPGCRINTCSHGRATELMASSVRTNH 164 Y EC+ + N + F+P+ PGC + ++ +L++ SV NH Sbjct: 353 YAECLSDSAIFVQSRNCNHHHGFHPSTVCKIPPGCSLKIFNNQEFAQLLSQSV--NH 407 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 7.4 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -1 Query: 243 PNPDAGSTPAHTVAPLN*WHPVFVLTTWLEDAVVTSGKPSFPTAMV 106 PN + PAH V L W V++ + + S +PTA V Sbjct: 559 PNRERVLWPAHNVRDLRLWTEVYLGSWGGHNQPSASEVADYPTASV 604 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 7.4 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -1 Query: 243 PNPDAGSTPAHTVAPLN*WHPVFVLTTWLEDAVVTSGKPSFPTAMV 106 PN + PAH V L W V++ + + S +PTA V Sbjct: 559 PNRERVLWPAHNVRDLRLWTEVYLGSWGGHNQPSASEVADYPTASV 604 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 7.4 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 372 PHCGPAGSKPVTRAGRPPAWRPALPTT*APKLKPIR 479 P C ++ +R+ RP +W + PT+ PK P R Sbjct: 269 PSCRSPPARRRSRSTRPTSWPRSRPTS-KPKRLPRR 303 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 401 CNACGATTGLASGITNDV 454 C CG T ASG TN+V Sbjct: 488 CLRCGDQTHKASGCTNEV 505 >DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 144 PQRLPTKWLVRTLDAINSV 200 P RL +W V+ L A+N + Sbjct: 37 PDRLTRRWYVKVLIAVNLI 55 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 369 ETLTHSTAMLVITSNAS 319 E LTH ML I SNAS Sbjct: 470 EKLTHIETMLQIASNAS 486 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = +2 Query: 329 DVMTSIAVECVRVSSPLWSGGVQTCNACGATTGLASGITNDVS 457 D++ C++ +T + ATTG A+ +TN+ + Sbjct: 5 DIIKKCVSHCLQYILTEGPPAKKTSSTANATTGAANAVTNNAT 47 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = +2 Query: 329 DVMTSIAVECVRVSSPLWSGGVQTCNACGATTGLASGITNDVS 457 D++ C++ +T + ATTG A+ +TN+ + Sbjct: 5 DIIKKCVSHCLQYILTEGPPAKKTSSTANATTGAANAVTNNAT 47 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 29 KTSSTANATTGAANAITNNAT 49 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 395 QTCNACGATTGLASGITNDVS 457 +T + ATTG A+ ITN+ + Sbjct: 27 KTSSTANATTGAANAITNNAT 47 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 451 VVGNAGRQAGGRPARVTGLDPAGPQWGGNSNALNRN 344 ++GN +GG +G+ GP G +AL N Sbjct: 14 LLGNGSSSSGGGVGLGSGIGGTGPSSPGEESALVGN 49 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 577 NTAAAGVPDVGRALGNFLVWLINNAGG 497 N ++A P GRA G+ + + I N GG Sbjct: 505 NPSSAVTPGGGRAEGDKVTFQIPNGGG 531 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 890,439 Number of Sequences: 2352 Number of extensions: 21980 Number of successful extensions: 146 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -