BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h22r (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 23 3.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 7.1 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 9.3 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +2 Query: 200 TYK*INKILLRTIVVLFYNLFIYSKIQHELSP*WRGFYYL 319 TY+ ++ + V F++ +I + + + +S FYYL Sbjct: 29 TYRLYKIFVVFSFAVTFFSAWICALVNYNVSEISENFYYL 68 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = +3 Query: 180 YNKAVEGHINKLTKSCYEQSWFY 248 Y +A + ++++ + E SWFY Sbjct: 1154 YMEAPQDNVSQPSDEVMENSWFY 1176 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = +3 Query: 180 YNKAVEGHINKLTKSCYEQSWFY 248 Y +A + ++++ + E SWFY Sbjct: 1154 YMEAPQDNVSQPSDEVMENSWFY 1176 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 165 KNPTLKNVCTYIDFQYSISS 106 K TLK YIDF Y + S Sbjct: 133 KIQTLKLAARYIDFLYHVLS 152 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 9.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 452 IIKSFKLIYKAYHKSLFERGHHCKFFYPLLNWAN 553 +I+SFK YK ++ L K L+N AN Sbjct: 192 LIRSFKSRYKDLNQKLETACEQSKSVEELMNIAN 225 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,259 Number of Sequences: 336 Number of extensions: 3030 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -