Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV11h22r
         (681 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0498 + 19721038-19721178,19721376-19721472,19721576-197216...    29   4.5  

>12_02_0498 +
           19721038-19721178,19721376-19721472,19721576-19721619,
           19722120-19722203,19722441-19722662
          Length = 195

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +2

Query: 398 SSEYQTSSLLCLF*GRTC-IIKSFKLIYKAYHKSLFERGHHCKFFYPLLNWANG*KTFAS 574
           ++ +Q ++  C+   +T  ++       + YHK+ F R HHCK    L N+ +       
Sbjct: 2   ATSFQGTTTKCMACDKTVYLVDKLTADNRVYHKACF-RCHHCKGTLKLANYNSFEGVLYC 60

Query: 575 RDHF 586
           R HF
Sbjct: 61  RPHF 64


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,735,997
Number of Sequences: 37544
Number of extensions: 256151
Number of successful extensions: 449
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 443
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 449
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1721314888
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)