BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h21r (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase pr... 50 9e-08 AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase pr... 50 9e-08 AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase pr... 50 9e-08 AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase pr... 50 9e-08 AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase pr... 50 9e-08 AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase pr... 50 9e-08 AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase pr... 50 9e-08 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 29 0.19 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 29 0.19 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 26 1.3 Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease prot... 25 2.3 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 23 7.0 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 9.2 >AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 49.6 bits (113), Expect = 9e-08 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = -1 Query: 699 FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--KKGSITSVQAIYVPADDLT 526 + +A EVSA +P G+ + TD+ T+ ER + GSIT + + +P DD+T Sbjct: 139 YAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDIT 198 Query: 525 DPAPATTFAHLDATTVLSRAIAELGIYPAVDPL 427 P P T + + R + IYP V+ L Sbjct: 199 HPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVL 231 >AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 49.6 bits (113), Expect = 9e-08 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = -1 Query: 699 FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--KKGSITSVQAIYVPADDLT 526 + +A EVSA +P G+ + TD+ T+ ER + GSIT + + +P DD+T Sbjct: 139 YAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDIT 198 Query: 525 DPAPATTFAHLDATTVLSRAIAELGIYPAVDPL 427 P P T + + R + IYP V+ L Sbjct: 199 HPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVL 231 >AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 49.6 bits (113), Expect = 9e-08 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = -1 Query: 699 FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--KKGSITSVQAIYVPADDLT 526 + +A EVSA +P G+ + TD+ T+ ER + GSIT + + +P DD+T Sbjct: 139 YAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDIT 198 Query: 525 DPAPATTFAHLDATTVLSRAIAELGIYPAVDPL 427 P P T + + R + IYP V+ L Sbjct: 199 HPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVL 231 >AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 49.6 bits (113), Expect = 9e-08 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = -1 Query: 699 FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--KKGSITSVQAIYVPADDLT 526 + +A EVSA +P G+ + TD+ T+ ER + GSIT + + +P DD+T Sbjct: 139 YAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDIT 198 Query: 525 DPAPATTFAHLDATTVLSRAIAELGIYPAVDPL 427 P P T + + R + IYP V+ L Sbjct: 199 HPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVL 231 >AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 49.6 bits (113), Expect = 9e-08 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = -1 Query: 699 FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--KKGSITSVQAIYVPADDLT 526 + +A EVSA +P G+ + TD+ T+ ER + GSIT + + +P DD+T Sbjct: 139 YAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDIT 198 Query: 525 DPAPATTFAHLDATTVLSRAIAELGIYPAVDPL 427 P P T + + R + IYP V+ L Sbjct: 199 HPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVL 231 >AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 49.6 bits (113), Expect = 9e-08 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = -1 Query: 699 FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--KKGSITSVQAIYVPADDLT 526 + +A EVSA +P G+ + TD+ T+ ER + GSIT + + +P DD+T Sbjct: 139 YAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDIT 198 Query: 525 DPAPATTFAHLDATTVLSRAIAELGIYPAVDPL 427 P P T + + R + IYP V+ L Sbjct: 199 HPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVL 231 >AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 49.6 bits (113), Expect = 9e-08 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = -1 Query: 699 FTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--KKGSITSVQAIYVPADDLT 526 + +A EVSA +P G+ + TD+ T+ ER + GSIT + + +P DD+T Sbjct: 139 YAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDIT 198 Query: 525 DPAPATTFAHLDATTVLSRAIAELGIYPAVDPL 427 P P T + + R + IYP V+ L Sbjct: 199 HPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVL 231 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 28.7 bits (61), Expect = 0.19 Identities = 17/61 (27%), Positives = 31/61 (50%) Frame = -1 Query: 594 ITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTS 415 +++ K +++S A+ + +P P + F HLD +T A AEL P++ D + Sbjct: 96 LSSRKSPTVSSAAALNSGFPSIANPNPRSPFRHLDFST---SATAELRRNPSLSAPDECA 152 Query: 414 R 412 R Sbjct: 153 R 153 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 28.7 bits (61), Expect = 0.19 Identities = 17/61 (27%), Positives = 31/61 (50%) Frame = -1 Query: 594 ITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTS 415 +++ K +++S A+ + +P P + F HLD +T A AEL P++ D + Sbjct: 96 LSSRKSPTVSSAAALNSGFPSIANPNPRSPFRHLDFST---SATAELRRNPSLSAPDECA 152 Query: 414 R 412 R Sbjct: 153 R 153 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 25.8 bits (54), Expect = 1.3 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -1 Query: 657 IPSAVGYQPTL---ATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPAT 508 I + VG+Q L +G + E I + T +Q P + +DP PAT Sbjct: 82 IGAQVGFQAALNSAVAAIGKLVEPIVAEVRSGFTLLQTASTPHNRNSDPRPAT 134 >Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease protein. Length = 268 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 222 VAEVFTGHAGKLVPLEETIKGFSKILAGDYD 130 +AE F AG VP + GF + +AG++D Sbjct: 64 IAEKFVLTAGHCVPSAISPDGFPEAVAGEHD 94 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 687 GSEVSALLGRIPSAVGYQPT--LATDMG 610 G++ A+LG+I AVG T + DMG Sbjct: 125 GADAGAVLGKIHEAVGESGTARVVADMG 152 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -1 Query: 195 GKLVPLEETI--KGFSKILAGDYDHL 124 GK+V + + KGFS++ DYD + Sbjct: 487 GKIVQYKARLVAKGFSQVYGADYDEV 512 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,600 Number of Sequences: 2352 Number of extensions: 16535 Number of successful extensions: 63 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -