BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h21f (602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 175 2e-44 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 175 2e-44 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 175 2e-44 At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial... 58 4e-09 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 44 8e-05 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 44 8e-05 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 44 1e-04 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 44 1e-04 At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putati... 44 1e-04 At3g54040.1 68416.m05975 photoassimilate-responsive protein-rela... 31 0.59 At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN ... 30 1.4 At4g34340.1 68417.m04880 expressed protein 29 2.4 At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains... 27 7.2 At3g62640.1 68416.m07036 expressed protein 27 7.2 At3g52640.1 68416.m05799 nicastrin-related contains weak similar... 27 7.2 At2g33640.1 68415.m04124 zinc finger (DHHC type) family protein ... 27 7.2 At1g28380.1 68414.m03487 expressed protein 27 7.2 At5g39880.1 68418.m04837 expressed protein 27 9.6 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 175 bits (426), Expect = 2e-44 Identities = 85/127 (66%), Positives = 102/127 (80%), Gaps = 2/127 (1%) Frame = +3 Query: 225 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 398 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 95 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 154 Query: 399 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIKV 578 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP VD++ QEIL TGIKV Sbjct: 155 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPALVDLATGQEILATGIKV 214 Query: 579 VDLLAPY 599 VDLLAPY Sbjct: 215 VDLLAPY 221 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 175 bits (426), Expect = 2e-44 Identities = 85/127 (66%), Positives = 102/127 (80%), Gaps = 2/127 (1%) Frame = +3 Query: 225 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 398 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 98 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 157 Query: 399 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIKV 578 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP VD++ QEIL TGIKV Sbjct: 158 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPALVDLATGQEILATGIKV 217 Query: 579 VDLLAPY 599 VDLLAPY Sbjct: 218 VDLLAPY 224 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 175 bits (426), Expect = 2e-44 Identities = 85/127 (66%), Positives = 102/127 (80%), Gaps = 2/127 (1%) Frame = +3 Query: 225 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 398 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 95 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 154 Query: 399 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIKV 578 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP VD++ QEIL TGIKV Sbjct: 155 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPALVDLATGQEILATGIKV 214 Query: 579 VDLLAPY 599 VDLLAPY Sbjct: 215 VDLLAPY 221 >At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial, putative very strong similarity to SP|P23413 ATP synthase alpha chain, mitochondrial (EC 3.6.3.14) {Brassica campestris}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 777 Score = 58.0 bits (134), Expect = 4e-09 Identities = 28/97 (28%), Positives = 48/97 (49%) Frame = +3 Query: 306 VAQHLGENTVRTIAMDGTEGLVRGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 485 +A +L V + G + G V +GS + +P G LGR+++ +G PID +G + Sbjct: 334 MALNLENENVGIVVFGGDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDAMGVPIDGKGAL 393 Query: 486 PTDKTAAIHAEAPEFVDMSVQQEILVTGIKVVDLLAP 596 + + +AP ++ E + TG+K VD L P Sbjct: 394 SDHEQRRVEVKAPGILERKSVHEPMQTGLKAVDSLVP 430 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 44.0 bits (99), Expect = 8e-05 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 1/91 (1%) Frame = +3 Query: 321 GENTVRTIAMDGTEGLVRGQPVLD-SGSPIRIPVGAETLGRIINVIGEPIDERGPIPTDK 497 GE V + +GT G+ + +G ++ PV + LGRI N G+PID PI + Sbjct: 64 GEKAVVQV-FEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEA 122 Query: 498 TAAIHAEAPEFVDMSVQQEILVTGIKVVDLL 590 I + + + +E++ TGI +D++ Sbjct: 123 YLDISGSSINPSERTYPEEMIQTGISTIDVM 153 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 44.0 bits (99), Expect = 8e-05 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 1/91 (1%) Frame = +3 Query: 321 GENTVRTIAMDGTEGLVRGQPVLD-SGSPIRIPVGAETLGRIINVIGEPIDERGPIPTDK 497 GE V + +GT G+ + +G ++ PV + LGRI N G+PID PI + Sbjct: 64 GEKAVVQV-FEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEA 122 Query: 498 TAAIHAEAPEFVDMSVQQEILVTGIKVVDLL 590 I + + + +E++ TGI +D++ Sbjct: 123 YLDISGSSINPSERTYPEEMIQTGISTIDVM 153 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 43.6 bits (98), Expect = 1e-04 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 1/91 (1%) Frame = +3 Query: 321 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPIPTDK 497 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI + Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEA 121 Query: 498 TAAIHAEAPEFVDMSVQQEILVTGIKVVDLL 590 I + + + +E++ TGI +D++ Sbjct: 122 YLDISGSSINPSERTYPEEMIQTGISTIDVM 152 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 43.6 bits (98), Expect = 1e-04 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 1/91 (1%) Frame = +3 Query: 321 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPIPTDK 497 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI + Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEA 121 Query: 498 TAAIHAEAPEFVDMSVQQEILVTGIKVVDLL 590 I + + + +E++ TGI +D++ Sbjct: 122 YLDISGSSINPSERTYPEEMIQTGISTIDVM 152 >At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 330 Score = 43.6 bits (98), Expect = 1e-04 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 1/91 (1%) Frame = +3 Query: 321 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPIPTDK 497 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI + Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEA 121 Query: 498 TAAIHAEAPEFVDMSVQQEILVTGIKVVDLL 590 I + + + +E++ TGI +D++ Sbjct: 122 YLDISGSSINPSERTYPEEMIQTGISTIDVM 152 >At3g54040.1 68416.m05975 photoassimilate-responsive protein-related contains weak similarity to mRNA inducible by sucrose and salicylic acid expressed in sugar-accumulating tobacco plants (GI:871487) [Nicotiana tabacum] Length = 183 Score = 31.1 bits (67), Expect = 0.59 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +3 Query: 240 DNLPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLV 371 +NLP + + + R +LE A GE T RT A+D EG+V Sbjct: 29 ENLPTNMCSFSISASGKRCILETANVAGEFTCRTSAVD-VEGIV 71 >At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN protein (ETT) identical to ETTIN GB:AF007788 from [Arabidopsis thaliana] Length = 608 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 330 CSHPNVGLPQVRGGEIDFAPQGHLESEAGY-LRIAHLPQH 214 C+ P + LP+ RG + + PQGHLE + I LP H Sbjct: 59 CAGPLISLPK-RGSLVLYFPQGHLEQAPDFSAAIYGLPPH 97 >At4g34340.1 68417.m04880 expressed protein Length = 353 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 485 DGTTLVNRFADYIDDATEGFSSHRDTNW 402 DG +++ FA ++ A +GFSS T W Sbjct: 259 DGLSVIEAFAPAMEAARDGFSSEAHTEW 286 >At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains Pfam profile: PF02362 B3 DNA binding domain; identical to cDNA auxin response factor 4 (ARF4) GI:4102597 Length = 788 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 330 CSHPNVGLPQVRGGEIDFAPQGHLESEA 247 C+ P LP+ +G + + PQGHLE +A Sbjct: 70 CAGPLTCLPK-KGNVVVYFPQGHLEQDA 96 >At3g62640.1 68416.m07036 expressed protein Length = 110 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/65 (24%), Positives = 27/65 (41%) Frame = -2 Query: 430 VSAPTGIRIGEPESSTGCPRTKPSVPSMAMVRTVFSPKCWATSSTRRGDRFCTSRAFRIG 251 V T + P+S P P S + RT +P + T+R R T + + + Sbjct: 27 VGGTTQVYSTRPDSPKFQPSIPPPPGSTSKTRTTATPWRLIDAETKRKKRIATYKTYALE 86 Query: 250 GRLSS 236 G++ S Sbjct: 87 GKVKS 91 >At3g52640.1 68416.m05799 nicastrin-related contains weak similarity to Nicastrin precursor (Swiss-Prot:Q92542) [Homo sapiens] Length = 676 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -1 Query: 584 IDDFYTSYENLLLHRHVDKLWSFSMNSSSLV 492 ++DF T++ N H H+D L ++NSSS+V Sbjct: 421 LEDFDTNFVNKFYHSHLDDL--SNINSSSVV 449 >At2g33640.1 68415.m04124 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 565 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 438 DRGFQLP-PGYELVSQSLVRVAHGLSLQYRPWQWSELCSHPNVGLPQ 301 D+ Q P P V+ + R + GLS+QYR + LC+ PN+ + Q Sbjct: 295 DQTSQYPSPASSAVTATSARSSLGLSIQYR---GASLCTPPNIFVDQ 338 >At1g28380.1 68414.m03487 expressed protein Length = 612 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -2 Query: 565 VTRISCCTDMSTN---SGASA*IAAVLSVGMGPRSSIGSP 455 VTR SC ++STN SG + I+ LS G+ P + P Sbjct: 498 VTRKSCWDNLSTNSRKSGVFSMISTRLSTGLSPNPATTKP 537 >At5g39880.1 68418.m04837 expressed protein Length = 363 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 133 LQSMPLTRGTMLLNLQEKAKVRLLPLSVLW*MCNSKITCL 252 LQ++P T T +LN +E++ + ++ MC +T L Sbjct: 44 LQTLPFTEITEILNRKERSAPKTPEFKAMFTMCKGYVTYL 83 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,338,754 Number of Sequences: 28952 Number of extensions: 280300 Number of successful extensions: 754 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -