BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h20r (728 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4XRS9 Cluster: Putative uncharacterized protein; n=6; ... 39 0.11 UniRef50_A0NE42 Cluster: ENSANGP00000030073; n=1; Anopheles gamb... 33 5.4 >UniRef50_Q4XRS9 Cluster: Putative uncharacterized protein; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 1726 Score = 39.1 bits (87), Expect = 0.11 Identities = 22/66 (33%), Positives = 33/66 (50%) Frame = +2 Query: 437 NSSMQKCNNNVTLKVYLHTKYYCA*VIYLWCILFFVCLLNDINSRENHHN*RYLKVFYEL 616 N+ +Q C NN K+Y H KY +Y + LF I EN + +YLK+F + Sbjct: 427 NTFLQICVNNYDDKIYKHMKYLYFSNLYFYNPLFIFQYFQFIPISENKYYEKYLKIFLKF 486 Query: 617 RHNKIM 634 +N I+ Sbjct: 487 LNNIII 492 >UniRef50_A0NE42 Cluster: ENSANGP00000030073; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000030073 - Anopheles gambiae str. PEST Length = 68 Score = 33.5 bits (73), Expect = 5.4 Identities = 20/53 (37%), Positives = 30/53 (56%) Frame = +2 Query: 83 ACFINHKYLNCFQFLILKFYVFDIKTVQFCTGTYN*LFVIFFLLIHYNTFMDF 241 A F+N+ YL+ F F+ L + F+I V F + LF+++F YNTF F Sbjct: 18 AVFLNYVYLSFFYFVCL--FCFEICLVSFVLVLWLVLFLLYFFYF-YNTFALF 67 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,644,980 Number of Sequences: 1657284 Number of extensions: 10503902 Number of successful extensions: 22131 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22127 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 58853922985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -