BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h20r (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_25293| Best HMM Match : DUF1665 (HMM E-Value=0.098) 28 8.9 >SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 596 NIFNYDDFLWNLCRSINKRKKECTKDKLLTRNNI 495 ++ NY D + + SI KR+ EC K+ L +I Sbjct: 163 DLVNYPDRIDEILDSIKKRRDECVKELALLEKDI 196 >SB_25293| Best HMM Match : DUF1665 (HMM E-Value=0.098) Length = 1450 Score = 27.9 bits (59), Expect = 8.9 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +2 Query: 410 VVRIINML*NSSMQKCNNNVTLKVYLHTKYYCA*VIYLWCILFFVCLLNDINSRENHHN* 589 VV+ L + + N + K +L + C ++Y I +F+ ++N + N N Sbjct: 434 VVQFNTQLRQDAFIRLNGRLMAKYWLKITHVCLKIVYSRSIYYFI-VINTYSQSNNVLNR 492 Query: 590 R--YLKVFYELRH 622 R LK FY R+ Sbjct: 493 RKIVLKAFYSWRN 505 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,804,711 Number of Sequences: 59808 Number of extensions: 331483 Number of successful extensions: 589 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -