BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h20r (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 9.7 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 9.7 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 509 TRNNISCVNKLLVLHYYYIS 450 TRN I C L+LHY ++S Sbjct: 246 TRNVIRCELIALLLHYLHLS 265 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 9.7 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 41 TKNKNLAQSLLSITACFINHKYLNCFQFLILKFYVFDIKTV-QFC 172 T+ + L L + F +H++ F FL + V D++ V Q C Sbjct: 58 TRKRLLTDVLSDMYHRFASHRFFGYFDFLSPIYVVRDLELVKQIC 102 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,508 Number of Sequences: 2352 Number of extensions: 11630 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -