BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h20r (728 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024319-1|ABC86381.1| 342|Drosophila melanogaster IP11151p pro... 30 3.7 AE014134-491|AAF51193.2| 347|Drosophila melanogaster CG2983-PA ... 30 3.7 >BT024319-1|ABC86381.1| 342|Drosophila melanogaster IP11151p protein. Length = 342 Score = 29.9 bits (64), Expect = 3.7 Identities = 10/41 (24%), Positives = 25/41 (60%) Frame = +2 Query: 41 TKNKNLAQSLLSITACFINHKYLNCFQFLILKFYVFDIKTV 163 T++ A S +++ ++ H+Y++CF+++I + F K + Sbjct: 269 TQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQI 309 >AE014134-491|AAF51193.2| 347|Drosophila melanogaster CG2983-PA protein. Length = 347 Score = 29.9 bits (64), Expect = 3.7 Identities = 10/41 (24%), Positives = 25/41 (60%) Frame = +2 Query: 41 TKNKNLAQSLLSITACFINHKYLNCFQFLILKFYVFDIKTV 163 T++ A S +++ ++ H+Y++CF+++I + F K + Sbjct: 274 TQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQI 314 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,354,045 Number of Sequences: 53049 Number of extensions: 466585 Number of successful extensions: 749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3273062859 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -