BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h18f (764 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61180.1 68414.m06894 disease resistance protein (CC-NBS-LRR ... 32 0.48 At2g28540.1 68415.m03467 expressed protein 29 2.6 At3g59140.1 68416.m06593 ABC transporter family protein putative... 29 4.5 >At1g61180.1 68414.m06894 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 889 Score = 31.9 bits (69), Expect = 0.48 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = +3 Query: 357 FQKTTMMLIVKVTMAVEETETKTITLEMDTPTP----AWLLKYVLKKIQTVFWSPM 512 F ++L+++ + V E K + + TP WL+ Y L K+++++WSP+ Sbjct: 757 FAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPL 812 >At2g28540.1 68415.m03467 expressed protein Length = 655 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +2 Query: 131 TNKATKGVNFES-GKATEICARIGSDGILVAHEHCTRFYKCAEGRPVALKCPPNLLFNPS 307 TN GV+ E + T + + +G+ L A + + FY+ P L C N PS Sbjct: 188 TNANEVGVSREEVNRGTSLMSPLGTGHYLEAEDDISLFYRQRLKDPEVLSCQSNGFLRPS 247 Query: 308 N 310 N Sbjct: 248 N 248 >At3g59140.1 68416.m06593 ABC transporter family protein putative multi resistance protein mrp - Arabidopsis thaliana, EMBL:ATMRPPROT Length = 1453 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 722 FQVSFSFRFLXCHCHFHYQHPRRLLE*FCL 633 F ++ SF L C C FH + P+R+ + FCL Sbjct: 28 FGITLSFLTL-CICLFHKEPPKRIHQFFCL 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,547,115 Number of Sequences: 28952 Number of extensions: 271095 Number of successful extensions: 687 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -