BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h17r (742 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 4.3 L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 23 7.5 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 23 7.5 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 23 7.5 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 9.9 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = -3 Query: 155 PRYCSRAPCPGTCICRAAPGGT 90 P C R PCP C G T Sbjct: 770 PYDCKRCPCPNNGACMQMAGDT 791 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 229 VVGSYRPGRFGCLGRVLVRRARAGCPGTAAG 137 ++G YR G ++ R A GC TA G Sbjct: 172 IIGLYRGFNVSVQGIIIYRAAYFGCFDTAKG 202 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 229 VVGSYRPGRFGCLGRVLVRRARAGCPGTAAG 137 ++G YR G ++ R A GC TA G Sbjct: 172 IIGLYRGFNVSVQGIIIYRAAYFGCFDTAKG 202 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 229 VVGSYRPGRFGCLGRVLVRRARAGCPGTAAG 137 ++G YR G ++ R A GC TA G Sbjct: 172 IIGLYRGFNVSVQGIIIYRAAYFGCFDTAKG 202 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.0 bits (47), Expect = 9.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 236 PSGGWILPTRTLWLFG 189 P +++P RTL LFG Sbjct: 388 PGDAYVVPIRTLMLFG 403 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 892,477 Number of Sequences: 2352 Number of extensions: 21866 Number of successful extensions: 39 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -