BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h17f (609 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28911| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_7379| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 >SB_28911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 54.0 bits (124), Expect = 9e-08 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 9/85 (10%) Frame = +1 Query: 298 FEDCFNFGSLQWYGGPEQKQQYWPIQNS--NLQKY-------SIISKEEDNSAVSERYWL 450 F+D F + W+GG E Q WP++ + N+Q Y + +S V ERYWL Sbjct: 167 FQDDFRLDKMHWFGGSELYMQAWPLEKAEINMQPYIPSDTILNFLSNRTAYGGVLERYWL 226 Query: 451 NSAGQYFYVQPEAPLFIDYHNVEDN 525 NS G V E PL I ++ +N Sbjct: 227 NSNGIAIVVDEEVPLLIAINDSNNN 251 >SB_7379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 413 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 295 VFEDCFNFGSLQWYGGPEQKQQYW-PIQNSNLQ 390 VF D N L YG PEQK+++ P+ N ++ Sbjct: 124 VFSDSGNMEVLHLYGSPEQKKKWLDPLLNGEMR 156 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,517,669 Number of Sequences: 59808 Number of extensions: 405607 Number of successful extensions: 828 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -