BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h13r (692 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 1.8 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 2.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 3.1 DQ855502-1|ABH88189.1| 126|Tribolium castaneum chemosensory pro... 22 5.5 DQ855495-1|ABH88182.1| 126|Tribolium castaneum chemosensory pro... 22 5.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.6 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.4 bits (48), Expect = 1.8 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 429 KTSLMTASFCVWTILF-ISSILTLVSASILAATPSLV 536 KT L T +C + ILF +S + LV + L TP+ V Sbjct: 313 KTVLKTNKYCNFIILFYLSVFVILVYYASLDETPNPV 349 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 571 FHAPVCTFQLHLEPPP 618 FHA + LH PPP Sbjct: 151 FHAAATSLPLHYPPPP 166 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 3.1 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 411 MSYTRFKTSLMTAS-FCVWTILFISSILTLVSASILAATPSLV 536 +S T+ +L+TA +C I + +L + SIL PSL+ Sbjct: 400 LSKTKTFCTLVTALVYCSLAIFVLCELLIEGTTSILINVPSLI 442 >DQ855502-1|ABH88189.1| 126|Tribolium castaneum chemosensory protein 16 protein. Length = 126 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -1 Query: 683 KTRCGESQRGKEAKSETPKAGQGGGSR*S*KVQTGA*KAVQRI 555 K +C + G+E K + P+A Q G ++ + K + G K + + Sbjct: 50 KGKC--TPEGEELKKDIPEALQNGCAKCNEKHKEGVRKVIHHL 90 >DQ855495-1|ABH88182.1| 126|Tribolium castaneum chemosensory protein 9 protein. Length = 126 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -1 Query: 683 KTRCGESQRGKEAKSETPKAGQGGGSR*S*KVQTGA*KAVQRI 555 K +C + G+E K + P+A Q G ++ + K + G K + + Sbjct: 50 KGKC--TPEGEELKKDIPEALQNGCAKCNEKHKEGVRKVIHHL 90 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 561 KNLKPSTWVPGKVLRPRSM 505 KNL S ++ K RPRS+ Sbjct: 177 KNLYYSFYISDKAARPRSL 195 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 92 FSYLNFKLS*RILNTWNGTELISHTINYLA 181 +S++N ++L+ W ++ H YLA Sbjct: 371 YSFINNLTDRKLLSAWYMNTVLGHQNPYLA 400 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 92 FSYLNFKLS*RILNTWNGTELISHTINYLA 181 +S++N ++L+ W ++ H YLA Sbjct: 263 YSFINNLTDRKLLSAWYMNTVLGHQNPYLA 292 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,679 Number of Sequences: 336 Number of extensions: 2708 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -