BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h12f (338 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D5735E Cluster: PREDICTED: similar to ring finge... 57 7e-08 UniRef50_Q17EU4 Cluster: Ring finger protein; n=1; Aedes aegypti... 56 2e-07 UniRef50_UPI0000E4A6E8 Cluster: PREDICTED: hypothetical protein,... 55 3e-07 UniRef50_Q9VW25 Cluster: CG8786-PB; n=3; Diptera|Rep: CG8786-PB ... 54 5e-07 UniRef50_UPI00015B5EC7 Cluster: PREDICTED: similar to rCG42109; ... 53 1e-06 UniRef50_Q7ZUK0 Cluster: Ring finger protein 146; n=3; Clupeocep... 52 3e-06 UniRef50_Q9NTX7 Cluster: RING finger protein 146; n=28; Eumetazo... 52 3e-06 UniRef50_Q5DDM0 Cluster: SJCHGC09082 protein; n=2; Schistosoma j... 50 8e-06 UniRef50_UPI0000519B18 Cluster: PREDICTED: similar to ring finge... 50 1e-05 UniRef50_UPI000023E27B Cluster: hypothetical protein FG07753.1; ... 44 9e-04 UniRef50_Q5RIK0 Cluster: Novel protein; n=7; Danio rerio|Rep: No... 42 0.002 UniRef50_Q96EQ8 Cluster: E3 ubiquitin-protein ligase RNF125; n=1... 42 0.003 UniRef50_Q9SYU4 Cluster: Peroxisome assembly protein 10; n=5; Ma... 42 0.003 UniRef50_UPI00001C46D6 Cluster: PREDICTED: similar to Ret finger... 42 0.004 UniRef50_UPI00005A581F Cluster: PREDICTED: similar to Tripartite... 41 0.005 UniRef50_Q2QUC7 Cluster: Zinc finger, C3HC4 type family protein,... 41 0.005 UniRef50_Q60PN3 Cluster: Putative uncharacterized protein CBG221... 41 0.005 UniRef50_A0CIY1 Cluster: Chromosome undetermined scaffold_19, wh... 41 0.005 UniRef50_A0BVZ1 Cluster: Chromosome undetermined scaffold_130, w... 41 0.005 UniRef50_A0D8C6 Cluster: Chromosome undetermined scaffold_401, w... 41 0.006 UniRef50_A0CBY0 Cluster: Chromosome undetermined scaffold_165, w... 41 0.006 UniRef50_O60683-2 Cluster: Isoform 2 of O60683 ; n=5; Theria|Rep... 40 0.008 UniRef50_O60683 Cluster: Peroxisome assembly protein 10; n=18; E... 40 0.008 UniRef50_UPI0000F21335 Cluster: PREDICTED: similar to bloodthirs... 40 0.011 UniRef50_A4RWX9 Cluster: Predicted protein; n=1; Ostreococcus lu... 40 0.011 UniRef50_Q4QIQ6 Cluster: Putative uncharacterized protein; n=3; ... 40 0.011 UniRef50_Q4N154 Cluster: Putative uncharacterized protein; n=2; ... 40 0.011 UniRef50_Q4DP57 Cluster: Putative uncharacterized protein; n=2; ... 40 0.011 UniRef50_A5DGM2 Cluster: Putative uncharacterized protein; n=1; ... 40 0.011 UniRef50_A3LX14 Cluster: Predicted protein; n=2; Saccharomycetac... 40 0.011 UniRef50_Q9LTZ6 Cluster: Arabidopsis thaliana genomic DNA, chrom... 40 0.014 UniRef50_A7S5K6 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.014 UniRef50_Q5A1M4 Cluster: Potential zinc RING finger protein; n=2... 40 0.014 UniRef50_UPI00015A6700 Cluster: hypothetical protein LOC793961 (... 39 0.019 UniRef50_Q08CC9 Cluster: Zgc:153258; n=7; Danio rerio|Rep: Zgc:1... 39 0.019 UniRef50_Q6NLR3 Cluster: At2g44410; n=2; Arabidopsis thaliana|Re... 39 0.019 UniRef50_Q00WB9 Cluster: Pex10p; n=2; Ostreococcus|Rep: Pex10p -... 39 0.019 UniRef50_O64425 Cluster: RMA1 protein; n=1; Arabidopsis thaliana... 39 0.019 UniRef50_Q8WQB0 Cluster: Putative uncharacterized protein; n=3; ... 39 0.019 UniRef50_Q57WU1 Cluster: Putative uncharacterized protein; n=1; ... 39 0.019 UniRef50_A7T4K5 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.019 UniRef50_A7RI91 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.019 UniRef50_Q875B4 Cluster: Putative uncharacterized protein Pa5D00... 39 0.019 UniRef50_UPI000155BACC Cluster: PREDICTED: similar to ZNF173; n=... 39 0.025 UniRef50_UPI0001556217 Cluster: PREDICTED: similar to RET finger... 39 0.025 UniRef50_A4IG09 Cluster: Si:dkey-7b17.2 protein; n=25; Clupeocep... 39 0.025 UniRef50_Q9SRX9 Cluster: F22D16.14 protein; n=2; Arabidopsis tha... 39 0.025 UniRef50_Q86L97 Cluster: Similar to Arabidopsis thaliana (Mouse-... 39 0.025 UniRef50_UPI0000F2DA65 Cluster: PREDICTED: similar to zinc finge... 38 0.033 UniRef50_UPI0000F2108D Cluster: PREDICTED: similar to RING finge... 38 0.033 UniRef50_UPI00005844F3 Cluster: PREDICTED: similar to apoptosis ... 38 0.033 UniRef50_UPI00006A0E29 Cluster: Zinc finger protein 179 (Brain f... 38 0.033 UniRef50_UPI0000ECB384 Cluster: UPI0000ECB384 related cluster; n... 38 0.033 UniRef50_Q6K9N9 Cluster: Putative PRT1 protein; n=3; Oryza sativ... 38 0.033 UniRef50_P93030 Cluster: RING zinc finger protein; n=1; Arabidop... 38 0.033 UniRef50_Q9XWM0 Cluster: Putative uncharacterized protein; n=2; ... 38 0.033 UniRef50_Q7R1C3 Cluster: GLP_306_45927_45298; n=1; Giardia lambl... 38 0.033 UniRef50_Q7QQF6 Cluster: GLP_91_8176_7298; n=1; Giardia lamblia ... 38 0.033 UniRef50_Q0UX22 Cluster: Putative uncharacterized protein; n=1; ... 38 0.033 UniRef50_Q86WT6 Cluster: Tripartite motif-containing protein 69;... 38 0.033 UniRef50_UPI00015563EB Cluster: PREDICTED: similar to Tripartite... 38 0.044 UniRef50_UPI0001554FA4 Cluster: PREDICTED: similar to tripartite... 38 0.044 UniRef50_UPI0000F1F5F9 Cluster: PREDICTED: hypothetical protein;... 38 0.044 UniRef50_UPI0000E48C43 Cluster: PREDICTED: similar to helicase-l... 38 0.044 UniRef50_UPI0000545748 Cluster: PREDICTED: hypothetical protein;... 38 0.044 UniRef50_UPI00015A73E5 Cluster: UPI00015A73E5 related cluster; n... 38 0.044 UniRef50_UPI0000F34814 Cluster: Tripartite motif-containing prot... 38 0.044 UniRef50_Q567F9 Cluster: Wu:fb13h06 protein; n=7; Danio rerio|Re... 38 0.044 UniRef50_Q9VJB0 Cluster: CG15150-PA; n=1; Drosophila melanogaste... 38 0.044 UniRef50_O17719 Cluster: Putative uncharacterized protein; n=1; ... 38 0.044 UniRef50_A2SVB5 Cluster: TRAF6; n=1; Chlamys farreri|Rep: TRAF6 ... 38 0.044 UniRef50_A4QRH5 Cluster: Putative uncharacterized protein; n=1; ... 38 0.044 UniRef50_A2R1D2 Cluster: Contig An13c0040, complete genome; n=10... 38 0.044 UniRef50_Q9Y508 Cluster: Zinc finger protein 313; n=29; Euteleos... 38 0.044 UniRef50_Q8LBL5 Cluster: E3 ubiquitin-protein ligase PRT1; n=1; ... 38 0.044 UniRef50_UPI0001556330 Cluster: PREDICTED: similar to hCG1811307... 38 0.058 UniRef50_Q7XI36 Cluster: Putative DEAD/H (Asp-Glu-Ala-Asp/His) b... 38 0.058 UniRef50_A3A0Z1 Cluster: Putative uncharacterized protein; n=5; ... 38 0.058 UniRef50_Q4QPY0 Cluster: IP05667p; n=1; Drosophila melanogaster|... 38 0.058 UniRef50_Q4Q1N0 Cluster: Putative uncharacterized protein; n=3; ... 38 0.058 UniRef50_A7AVG7 Cluster: Zinc finger protein, putative; n=1; Bab... 38 0.058 UniRef50_A2TK70 Cluster: Tumor necrosis factor receptor-associat... 38 0.058 UniRef50_A0CJI5 Cluster: Chromosome undetermined scaffold_2, who... 38 0.058 UniRef50_Q7SDX8 Cluster: Putative uncharacterized protein NCU032... 38 0.058 UniRef50_Q4P9E6 Cluster: Putative uncharacterized protein; n=1; ... 38 0.058 UniRef50_Q0Q0M9 Cluster: RING-1; n=2; Gibberella zeae|Rep: RING-... 38 0.058 UniRef50_A6R7U0 Cluster: Putative uncharacterized protein; n=1; ... 38 0.058 UniRef50_A6QYV1 Cluster: Predicted protein; n=1; Ajellomyces cap... 38 0.058 UniRef50_O00635 Cluster: Tripartite motif-containing protein 38;... 38 0.058 UniRef50_P46579 Cluster: Probable tryptophanyl-tRNA synthetase, ... 38 0.058 UniRef50_UPI00015561A2 Cluster: PREDICTED: similar to 52 kDa Ro ... 37 0.077 UniRef50_UPI0001554E35 Cluster: PREDICTED: similar to brain fing... 37 0.077 UniRef50_UPI0000F1D5F9 Cluster: PREDICTED: similar to MGC131155 ... 37 0.077 UniRef50_UPI0000E80EEF Cluster: PREDICTED: hypothetical protein;... 37 0.077 UniRef50_Q5TZ71 Cluster: Novel zinc finger protein; n=3; Clupeoc... 37 0.077 UniRef50_Q502G4 Cluster: Wu:fi33g05 protein; n=6; Danio rerio|Re... 37 0.077 UniRef50_Q4SZ81 Cluster: Chromosome undetermined SCAF11805, whol... 37 0.077 UniRef50_Q00SP9 Cluster: E3 ubiquitin ligase; n=2; Ostreococcus|... 37 0.077 UniRef50_Q4QI41 Cluster: Putative uncharacterized protein; n=3; ... 37 0.077 UniRef50_Q1RPY5 Cluster: Zinc finger protein; n=1; Ciona intesti... 37 0.077 UniRef50_A7APP9 Cluster: Putative uncharacterized protein; n=1; ... 37 0.077 UniRef50_Q8SU36 Cluster: Similarity to HYPOTHETICAL ZINC FINGER ... 37 0.077 UniRef50_Q0U7P5 Cluster: Putative uncharacterized protein; n=1; ... 37 0.077 UniRef50_O70418 Cluster: Zinc finger protein 179; n=12; Eutheria... 37 0.077 UniRef50_O14212 Cluster: Uncharacterized RING finger protein C6B... 37 0.077 UniRef50_UPI0000E80EEE Cluster: PREDICTED: similar to LOC432183 ... 37 0.10 UniRef50_UPI0000D9E507 Cluster: PREDICTED: similar to tripartite... 37 0.10 UniRef50_UPI00006604C6 Cluster: Homolog of Homo sapiens "Splice ... 37 0.10 UniRef50_A5PLE6 Cluster: Zgc:165577 protein; n=2; Danio rerio|Re... 37 0.10 UniRef50_Q9SZS2 Cluster: Putative RING zinc finger protein; n=2;... 37 0.10 UniRef50_Q8H0X2 Cluster: Expressed protein; n=4; core eudicotyle... 37 0.10 UniRef50_Q84SC7 Cluster: Zinc finger (C3HC4-type RING finger) pr... 37 0.10 UniRef50_Q67UM6 Cluster: Putative ring finger protein 10; n=3; O... 37 0.10 UniRef50_Q27U16 Cluster: Tripartite motif protein 5 alpha; n=5; ... 37 0.10 UniRef50_A0BPP8 Cluster: Chromosome undetermined scaffold_12, wh... 37 0.10 UniRef50_Q6FJ71 Cluster: Candida glabrata strain CBS138 chromoso... 37 0.10 UniRef50_Q2HD59 Cluster: Putative uncharacterized protein; n=1; ... 37 0.10 UniRef50_Q0UIT5 Cluster: Putative uncharacterized protein; n=1; ... 37 0.10 UniRef50_Q9ULX5 Cluster: Zinc finger protein 179; n=9; Eutheria|... 37 0.10 UniRef50_Q6PJ69 Cluster: Tripartite motif-containing protein 65;... 37 0.10 UniRef50_Q5EBN2 Cluster: Putative tripartite motif-containing pr... 37 0.10 UniRef50_Q96LD4 Cluster: Tripartite motif-containing protein 47;... 37 0.10 UniRef50_Q14527 Cluster: Helicase-like transcription factor; n=3... 37 0.10 UniRef50_UPI0001554FFF Cluster: PREDICTED: similar to zinc finge... 36 0.13 UniRef50_UPI0000F2D687 Cluster: PREDICTED: hypothetical protein;... 36 0.13 UniRef50_UPI0000F1D951 Cluster: PREDICTED: similar to novel zinc... 36 0.13 UniRef50_UPI0000F1D818 Cluster: PREDICTED: hypothetical protein;... 36 0.13 UniRef50_Q503I6 Cluster: Zgc:110566; n=14; Danio rerio|Rep: Zgc:... 36 0.13 UniRef50_Q4RGU8 Cluster: Chromosome undetermined SCAF15092, whol... 36 0.13 UniRef50_A4FUN6 Cluster: Zgc:136797 protein; n=52; Coelomata|Rep... 36 0.13 UniRef50_Q8R0K2 Cluster: Tripartite motif-containing 31; n=7; Mu... 36 0.13 UniRef50_Q0DHF0 Cluster: Os05g0470700 protein; n=6; Oryza sativa... 36 0.13 UniRef50_A7PVX9 Cluster: Chromosome chr8 scaffold_34, whole geno... 36 0.13 UniRef50_A4S5F4 Cluster: Predicted protein; n=2; Ostreococcus|Re... 36 0.13 UniRef50_Q9UAC4 Cluster: TRAF6; n=4; Sophophora|Rep: TRAF6 - Dro... 36 0.13 UniRef50_Q95ZB8 Cluster: RING finger protein; n=6; Trypanosomati... 36 0.13 UniRef50_Q7Q6I3 Cluster: ENSANGP00000017420; n=1; Anopheles gamb... 36 0.13 UniRef50_Q6LF01 Cluster: Putative c3h4-type ring finger protein;... 36 0.13 UniRef50_Q4Q883 Cluster: DNA repair protein-like protein; n=3; L... 36 0.13 UniRef50_Q38AW8 Cluster: Putative uncharacterized protein; n=1; ... 36 0.13 UniRef50_Q293B6 Cluster: GA14295-PA; n=1; Drosophila pseudoobscu... 36 0.13 UniRef50_A5K2A5 Cluster: Putative uncharacterized protein; n=1; ... 36 0.13 UniRef50_A2EBM4 Cluster: Putative uncharacterized protein; n=1; ... 36 0.13 UniRef50_A1A749 Cluster: IP17576p; n=2; Drosophila melanogaster|... 36 0.13 UniRef50_Q6FXK7 Cluster: Similarities with tr|Q06554 Saccharomyc... 36 0.13 UniRef50_Q6CGG7 Cluster: Similar to tr|Q06436 Saccharomyces cere... 36 0.13 UniRef50_A4RG64 Cluster: Putative uncharacterized protein; n=1; ... 36 0.13 UniRef50_A2QI07 Cluster: Contig An04c0100, complete genome; n=2;... 36 0.13 UniRef50_Q8NG06 Cluster: Tripartite motif-containing protein 58;... 36 0.13 UniRef50_Q9HCM9 Cluster: Tripartite motif-containing protein 39;... 36 0.13 UniRef50_Q12899 Cluster: Tripartite motif-containing protein 26;... 36 0.13 UniRef50_UPI0000F2D1E9 Cluster: PREDICTED: hypothetical protein;... 36 0.18 UniRef50_UPI0000F1F953 Cluster: PREDICTED: hypothetical protein;... 36 0.18 UniRef50_UPI0000E47F4C Cluster: PREDICTED: similar to Kelch moti... 36 0.18 UniRef50_UPI0000E47DF0 Cluster: PREDICTED: similar to ligand of ... 36 0.18 UniRef50_UPI00015A4985 Cluster: zgc:162037 (zgc:162037), mRNA; n... 36 0.18 UniRef50_UPI000069F651 Cluster: UPI000069F651 related cluster; n... 36 0.18 UniRef50_Q96K19-2 Cluster: Isoform 2 of Q96K19 ; n=4; Eutheria|R... 36 0.18 UniRef50_Q800L5 Cluster: Probable RING-B-box-coiled coil protein... 36 0.18 UniRef50_Q4SQS3 Cluster: Chromosome undetermined SCAF14531, whol... 36 0.18 UniRef50_Q4S3M0 Cluster: Chromosome 1 SCAF14749, whole genome sh... 36 0.18 UniRef50_Q3UWZ0 Cluster: In vitro fertilized eggs cDNA, RIKEN fu... 36 0.18 UniRef50_A7QZ00 Cluster: Chromosome undetermined scaffold_260, w... 36 0.18 UniRef50_A7QRA0 Cluster: Chromosome chr13 scaffold_149, whole ge... 36 0.18 UniRef50_Q68KK3 Cluster: TRIM5/cyclophilin A V3 fusion protein; ... 36 0.18 UniRef50_Q7JNM2 Cluster: Putative uncharacterized protein; n=3; ... 36 0.18 UniRef50_Q61UN6 Cluster: Putative uncharacterized protein CBG052... 36 0.18 UniRef50_Q55CM6 Cluster: Putative uncharacterized protein; n=1; ... 36 0.18 UniRef50_Q54S31 Cluster: Putative uncharacterized protein; n=1; ... 36 0.18 UniRef50_A2FB19 Cluster: Putative uncharacterized protein; n=1; ... 36 0.18 UniRef50_A0ED31 Cluster: Chromosome undetermined scaffold_9, who... 36 0.18 UniRef50_A0CL65 Cluster: Chromosome undetermined scaffold_20, wh... 36 0.18 UniRef50_A0C7Z2 Cluster: Chromosome undetermined scaffold_156, w... 36 0.18 UniRef50_Q000Q6 Cluster: RING-14 protein; n=1; Gibberella zeae|R... 36 0.18 UniRef50_A3LNG3 Cluster: Predicted protein; n=4; Saccharomycetal... 36 0.18 UniRef50_Q11096 Cluster: Uncharacterized RING finger protein C02... 36 0.18 UniRef50_Q9C029 Cluster: Tripartite motif-containing protein 7; ... 36 0.18 UniRef50_Q8BGE7 Cluster: Tripartite motif-containing protein 6; ... 36 0.18 UniRef50_Q495X7 Cluster: Tripartite motif-containing protein 60;... 36 0.18 UniRef50_Q96K19 Cluster: RING finger protein 170; n=27; Euteleos... 36 0.18 UniRef50_UPI000155BACB Cluster: PREDICTED: similar to ZNF173; n=... 36 0.24 UniRef50_UPI0000EBE1A7 Cluster: PREDICTED: similar to tripartite... 36 0.24 UniRef50_UPI0000E4A30D Cluster: PREDICTED: similar to ring finge... 36 0.24 UniRef50_UPI0000499D42 Cluster: hypothetical protein 113.t00010;... 36 0.24 UniRef50_UPI00015A7B11 Cluster: UPI00015A7B11 related cluster; n... 36 0.24 UniRef50_UPI00006601F1 Cluster: Homolog of Homo sapiens "Tripart... 36 0.24 UniRef50_UPI000065EA16 Cluster: Homolog of Homo sapiens "Ring fi... 36 0.24 UniRef50_Q8AW62 Cluster: Novel protein with RING finger domain; ... 36 0.24 UniRef50_Q5U3F5 Cluster: Zgc:103602; n=17; Danio rerio|Rep: Zgc:... 36 0.24 UniRef50_A5HUJ9 Cluster: Tripartite motif protein 7; n=2; Gallus... 36 0.24 UniRef50_Q9LUS4 Cluster: Similarity to transcription factors; n=... 36 0.24 UniRef50_Q9LSE3 Cluster: Emb|CAA66822.1; n=4; core eudicotyledon... 36 0.24 UniRef50_Q9LN67 Cluster: F18O14.3; n=13; Magnoliophyta|Rep: F18O... 36 0.24 UniRef50_Q8IQM1 Cluster: CG32847-PB; n=2; Drosophila melanogaste... 36 0.24 UniRef50_Q5CN55 Cluster: Zinc finger protein; n=3; Cryptosporidi... 36 0.24 UniRef50_Q22RW8 Cluster: Zinc finger, C3HC4 type; n=1; Tetrahyme... 36 0.24 UniRef50_Q18199 Cluster: Putative uncharacterized protein; n=1; ... 36 0.24 UniRef50_A0CG76 Cluster: Chromosome undetermined scaffold_179, w... 36 0.24 UniRef50_Q7SAR3 Cluster: Putative uncharacterized protein NCU079... 36 0.24 UniRef50_Q55NY4 Cluster: Putative uncharacterized protein; n=2; ... 36 0.24 UniRef50_Q1DR10 Cluster: Putative uncharacterized protein; n=1; ... 36 0.24 UniRef50_Q8WV44 Cluster: Tripartite motif-containing protein 41;... 36 0.24 UniRef50_Q9BZY9 Cluster: Tripartite motif-containing protein 31;... 36 0.24 UniRef50_Q92265 Cluster: Peroxisome assembly protein 10; n=2; Sa... 36 0.24 UniRef50_Q1L5Z9 Cluster: LON peptidase N-terminal domain and RIN... 36 0.24 UniRef50_Q8N448 Cluster: Ligand of Numb protein X 2; n=26; Eutel... 36 0.24 UniRef50_UPI0001554C5C Cluster: PREDICTED: similar to tripartite... 35 0.31 UniRef50_UPI0000F2B28A Cluster: PREDICTED: hypothetical protein;... 35 0.31 UniRef50_UPI0000F2B1A9 Cluster: PREDICTED: similar to tripartite... 35 0.31 UniRef50_UPI0000F21ADE Cluster: PREDICTED: hypothetical protein;... 35 0.31 UniRef50_UPI0000E4915D Cluster: PREDICTED: similar to TRAF6; n=1... 35 0.31 UniRef50_UPI0000E4784B Cluster: PREDICTED: similar to RFWD3 prot... 35 0.31 UniRef50_UPI00015A7073 Cluster: Zgc:85925.; n=1; Danio rerio|Rep... 35 0.31 UniRef50_UPI00015A6924 Cluster: UPI00015A6924 related cluster; n... 35 0.31 UniRef50_UPI000069FE11 Cluster: UPI000069FE11 related cluster; n... 35 0.31 UniRef50_UPI00004D3D5B Cluster: UPI00004D3D5B related cluster; n... 35 0.31 UniRef50_UPI000065F6EB Cluster: Homolog of Brachydanio rerio "Bl... 35 0.31 UniRef50_Q6IRC4 Cluster: MGC78802 protein; n=2; Xenopus|Rep: MGC... 35 0.31 UniRef50_Q5EVY2 Cluster: TRIM41; n=1; Gallus gallus|Rep: TRIM41 ... 35 0.31 UniRef50_Q4SQS6 Cluster: Chromosome undetermined SCAF14531, whol... 35 0.31 UniRef50_Q4RNB8 Cluster: Chromosome 1 SCAF15015, whole genome sh... 35 0.31 UniRef50_Q1RLT3 Cluster: Si:ch211-154o6.7 protein; n=7; Danio re... 35 0.31 UniRef50_Q08C26 Cluster: Zgc:153732; n=4; Danio rerio|Rep: Zgc:1... 35 0.31 UniRef50_A4VCF7 Cluster: Zgc:85925 protein; n=5; Euteleostomi|Re... 35 0.31 UniRef50_Q3TU94 Cluster: 18 days pregnant adult female placenta ... 35 0.31 UniRef50_Q8RXF2 Cluster: Putative uncharacterized protein At3g58... 35 0.31 UniRef50_Q25AG8 Cluster: B1011H02.2 protein; n=3; Oryza sativa|R... 35 0.31 UniRef50_A7Q035 Cluster: Chromosome chr8 scaffold_41, whole geno... 35 0.31 UniRef50_A4S4V7 Cluster: Predicted protein; n=1; Ostreococcus lu... 35 0.31 UniRef50_Q7QSA4 Cluster: GLP_663_7971_12074; n=1; Giardia lambli... 35 0.31 UniRef50_Q7QI38 Cluster: ENSANGP00000020505; n=2; Culicidae|Rep:... 35 0.31 UniRef50_Q7QDJ7 Cluster: ENSANGP00000015141; n=1; Anopheles gamb... 35 0.31 UniRef50_Q54ND8 Cluster: Putative uncharacterized protein; n=1; ... 35 0.31 UniRef50_Q4QAJ3 Cluster: Putative uncharacterized protein; n=4; ... 35 0.31 UniRef50_Q4QAJ2 Cluster: Putative uncharacterized protein; n=2; ... 35 0.31 UniRef50_Q4DYQ0 Cluster: Putative uncharacterized protein; n=1; ... 35 0.31 UniRef50_A7SSY6 Cluster: Predicted protein; n=1; Nematostella ve... 35 0.31 UniRef50_A7RVL2 Cluster: Predicted protein; n=1; Nematostella ve... 35 0.31 UniRef50_A7RRQ3 Cluster: Predicted protein; n=5; Nematostella ve... 35 0.31 UniRef50_A2FG27 Cluster: Ser/Thr protein phosphatase, putative; ... 35 0.31 UniRef50_A2EJL6 Cluster: Putative uncharacterized protein; n=1; ... 35 0.31 UniRef50_A0CSD3 Cluster: Chromosome undetermined scaffold_26, wh... 35 0.31 UniRef50_A0CPP5 Cluster: Chromosome undetermined scaffold_23, wh... 35 0.31 UniRef50_A6NK30 Cluster: Uncharacterized protein TRIM6; n=9; Eut... 35 0.31 UniRef50_Q8TFH8 Cluster: Ubiquitin-protein ligase E3; n=1; Schiz... 35 0.31 UniRef50_Q755X8 Cluster: AER390Wp; n=1; Eremothecium gossypii|Re... 35 0.31 UniRef50_Q9C030 Cluster: Tripartite motif-containing protein 6; ... 35 0.31 UniRef50_Q9C035 Cluster: Tripartite motif-containing protein 5; ... 35 0.31 UniRef50_UPI000155CFC7 Cluster: PREDICTED: hypothetical protein;... 35 0.41 UniRef50_UPI000155B9C7 Cluster: PREDICTED: similar to 52 kDa Ro ... 35 0.41 UniRef50_UPI000155661C Cluster: PREDICTED: hypothetical protein;... 35 0.41 UniRef50_UPI0000F2BF06 Cluster: PREDICTED: similar to pol polypr... 35 0.41 UniRef50_UPI0000EBE39A Cluster: PREDICTED: similar to tripartite... 35 0.41 UniRef50_UPI0000E80319 Cluster: PREDICTED: similar to LON peptid... 35 0.41 UniRef50_UPI0000E46C9B Cluster: PREDICTED: similar to peroxisoma... 35 0.41 UniRef50_UPI0000DB7BF4 Cluster: PREDICTED: similar to TNF-recept... 35 0.41 UniRef50_UPI0000588952 Cluster: PREDICTED: similar to zinc finge... 35 0.41 UniRef50_UPI0000499CAE Cluster: zinc finger protein; n=1; Entamo... 35 0.41 UniRef50_UPI00003C0D8C Cluster: PREDICTED: similar to CG7864-PA;... 35 0.41 UniRef50_UPI00015A7E0F Cluster: UPI00015A7E0F related cluster; n... 35 0.41 UniRef50_UPI00015A4CB3 Cluster: hypothetical protein LOC393254; ... 35 0.41 UniRef50_UPI00015A49D5 Cluster: Lnx2 protein; n=1; Danio rerio|R... 35 0.41 UniRef50_UPI0000D8E442 Cluster: UPI0000D8E442 related cluster; n... 35 0.41 UniRef50_UPI00006608F8 Cluster: Homolog of Brachydanio rerio "Bl... 35 0.41 UniRef50_Q9CWS1-2 Cluster: Isoform 2 of Q9CWS1 ; n=2; Mus muscul... 35 0.41 UniRef50_Q7ZU70 Cluster: Zgc:56368; n=3; Danio rerio|Rep: Zgc:56... 35 0.41 UniRef50_Q4T558 Cluster: Chromosome undetermined SCAF9424, whole... 35 0.41 UniRef50_Q4SV51 Cluster: Chromosome undetermined SCAF13803, whol... 35 0.41 UniRef50_Q28BW8 Cluster: Ring finger protein 127; n=5; Euteleost... 35 0.41 UniRef50_A7E224 Cluster: Lnx2 protein; n=3; Clupeocephala|Rep: L... 35 0.41 UniRef50_A5HUK4 Cluster: Tripartite motif protein 27; n=2; Gallu... 35 0.41 UniRef50_Q5SZ99 Cluster: Novel C3HC4 type zinc finger (Ring fing... 35 0.41 UniRef50_Q6H7E5 Cluster: Ring domain containing protein-like; n=... 35 0.41 UniRef50_A5B310 Cluster: Putative uncharacterized protein; n=2; ... 35 0.41 UniRef50_Q0VZ31 Cluster: Ligand of numb-protein X 3; n=2; Mammal... 35 0.41 UniRef50_Q9VSB2 Cluster: CG32369-PA, isoform A; n=4; Sophophora|... 35 0.41 UniRef50_Q8I1S9 Cluster: RING finger protein, putative; n=1; Pla... 35 0.41 UniRef50_Q7QIJ2 Cluster: ENSANGP00000021638; n=2; Culicidae|Rep:... 35 0.41 UniRef50_Q5C0S0 Cluster: SJCHGC05864 protein; n=1; Schistosoma j... 35 0.41 UniRef50_Q582U7 Cluster: Peroxin-2; n=3; Trypanosoma|Rep: Peroxi... 35 0.41 UniRef50_Q4XZX4 Cluster: Putative uncharacterized protein; n=1; ... 35 0.41 UniRef50_Q17LY4 Cluster: Putative uncharacterized protein; n=1; ... 35 0.41 UniRef50_A7ASW2 Cluster: Putative uncharacterized protein; n=1; ... 35 0.41 UniRef50_A2FM04 Cluster: Putative uncharacterized protein; n=1; ... 35 0.41 UniRef50_A0DRC8 Cluster: Chromosome undetermined scaffold_60, wh... 35 0.41 UniRef50_Q6C489 Cluster: Similarities with DEHA0D08514g Debaryom... 35 0.41 UniRef50_Q1DZC1 Cluster: Putative uncharacterized protein; n=1; ... 35 0.41 UniRef50_Q0UXB2 Cluster: Putative uncharacterized protein; n=2; ... 35 0.41 UniRef50_A6QVH0 Cluster: Putative uncharacterized protein; n=1; ... 35 0.41 UniRef50_A2QD73 Cluster: Contig An02c0180, complete genome; n=1;... 35 0.41 UniRef50_P87176 Cluster: Uncharacterized RING finger protein C3D... 35 0.41 UniRef50_Q6ZWI9 Cluster: Ret finger protein-like 4B; n=6; Euther... 35 0.41 UniRef50_Q75EN0 Cluster: Postreplication repair E3 ubiquitin-pro... 35 0.41 UniRef50_Q6VVB1 Cluster: NHL repeat-containing protein 1; n=14; ... 35 0.41 UniRef50_UPI0001555D5D Cluster: PREDICTED: similar to putative z... 34 0.54 UniRef50_UPI0000F1D6F7 Cluster: PREDICTED: similar to probable R... 34 0.54 UniRef50_UPI0000E46FA9 Cluster: PREDICTED: hypothetical protein;... 34 0.54 UniRef50_UPI0000D56882 Cluster: PREDICTED: similar to CG15105-PA... 34 0.54 UniRef50_UPI00015A5E64 Cluster: Novel protein similar to vertebr... 34 0.54 UniRef50_UPI0000D8D146 Cluster: UPI0000D8D146 related cluster; n... 34 0.54 UniRef50_UPI000069DF80 Cluster: UPI000069DF80 related cluster; n... 34 0.54 UniRef50_UPI000065E6E8 Cluster: Homolog of Homo sapiens "Splice ... 34 0.54 UniRef50_UPI0000EB1D8B Cluster: Tripartite motif family-like pro... 34 0.54 UniRef50_Q6DH90 Cluster: Zgc:92594; n=3; Danio rerio|Rep: Zgc:92... 34 0.54 UniRef50_Q5XG37 Cluster: LOC495222 protein; n=2; Xenopus|Rep: LO... 34 0.54 UniRef50_Q4SSB7 Cluster: Chromosome undetermined SCAF14473, whol... 34 0.54 UniRef50_Q4SQS0 Cluster: Chromosome undetermined SCAF14531, whol... 34 0.54 UniRef50_Q4RGH6 Cluster: Chromosome 18 SCAF15100, whole genome s... 34 0.54 UniRef50_A5HUK2 Cluster: Putative uncharacterized protein TRIM27... 34 0.54 UniRef50_A5HUK1 Cluster: Tripartite motif protein 39; n=2; Gallu... 34 0.54 UniRef50_A3KQE0 Cluster: Novel protein similar to vertebrate tri... 34 0.54 UniRef50_Q4KS92 Cluster: RING-finger-containing E3 ubiquitin lig... 34 0.54 UniRef50_Q8CDV4 Cluster: Adult male testis cDNA, RIKEN full-leng... 34 0.54 UniRef50_Q9SFU2 Cluster: Putative RING zinc finger protein; n=1;... 34 0.54 UniRef50_Q9C8E0 Cluster: RING zinc finger protein, putative; n=1... 34 0.54 UniRef50_Q6R567 Cluster: Ring domain containing protein; n=1; Ca... 34 0.54 UniRef50_A7PV14 Cluster: Chromosome chr4 scaffold_32, whole geno... 34 0.54 UniRef50_A4S5E2 Cluster: Predicted protein; n=1; Ostreococcus lu... 34 0.54 UniRef50_Q5U148 Cluster: LP20373p; n=4; Sophophora|Rep: LP20373p... 34 0.54 UniRef50_Q4Z2L1 Cluster: C3h4-type ring finger protein, putative... 34 0.54 UniRef50_Q32S42 Cluster: Tumor necrosis factor receptor associat... 34 0.54 UniRef50_A7RG36 Cluster: Predicted protein; n=1; Nematostella ve... 34 0.54 UniRef50_A0CGZ1 Cluster: Chromosome undetermined scaffold_18, wh... 34 0.54 UniRef50_A6NK02 Cluster: Uncharacterized protein TRIM75; n=4; Ca... 34 0.54 UniRef50_Q6C3F7 Cluster: Similar to tr|Q12161 Saccharomyces cere... 34 0.54 UniRef50_Q4WJ58 Cluster: RING finger domain protein (Rnf10), put... 34 0.54 UniRef50_Q4PB90 Cluster: Putative uncharacterized protein; n=1; ... 34 0.54 UniRef50_Q2H949 Cluster: Putative uncharacterized protein; n=1; ... 34 0.54 UniRef50_A6R1M6 Cluster: Predicted protein; n=1; Ajellomyces cap... 34 0.54 UniRef50_A2R450 Cluster: Function: COP1 of A. thaliana acts as a... 34 0.54 UniRef50_Q00940 Cluster: Peroxisome assembly protein 10; n=3; Pi... 34 0.54 UniRef50_Q8HXH0 Cluster: LON peptidase N-terminal domain and RIN... 34 0.54 UniRef50_Q496Y0 Cluster: LON peptidase N-terminal domain and RIN... 34 0.54 UniRef50_UPI0001555720 Cluster: PREDICTED: similar to RET finger... 34 0.72 UniRef50_UPI0000E4618C Cluster: PREDICTED: hypothetical protein,... 34 0.72 UniRef50_UPI0000D9F8BC Cluster: PREDICTED: similar to chromosome... 34 0.72 UniRef50_UPI0000D8A045 Cluster: hypothetical protein, conserved;... 34 0.72 UniRef50_UPI00006D02DB Cluster: hypothetical protein TTHERM_0094... 34 0.72 UniRef50_UPI000051A8E5 Cluster: PREDICTED: similar to CG32369-PB... 34 0.72 UniRef50_UPI00004999A4 Cluster: hypothetical protein 126.t00015;... 34 0.72 UniRef50_UPI00015A77EC Cluster: hypothetical protein LOC393144; ... 34 0.72 UniRef50_UPI00015A77CA Cluster: hypothetical protein LOC393144; ... 34 0.72 UniRef50_UPI000066034B Cluster: Homolog of Homo sapiens "gene ov... 34 0.72 UniRef50_UPI00003614D4 Cluster: Homolog of Notothenia coriiceps ... 34 0.72 UniRef50_Q7ZVQ7 Cluster: Zgc:55773; n=7; Clupeocephala|Rep: Zgc:... 34 0.72 UniRef50_Q5U485 Cluster: LOC495519 protein; n=17; Xenopus|Rep: L... 34 0.72 UniRef50_Q503E5 Cluster: Zgc:110667; n=4; Danio rerio|Rep: Zgc:1... 34 0.72 UniRef50_Q4T899 Cluster: Chromosome undetermined SCAF7858, whole... 34 0.72 UniRef50_Q4T7J8 Cluster: Chromosome undetermined SCAF8089, whole... 34 0.72 UniRef50_Q4SLD7 Cluster: Chromosome 7 SCAF14557, whole genome sh... 34 0.72 UniRef50_Q2VPQ0 Cluster: LOC432253 protein; n=6; Xenopus|Rep: LO... 34 0.72 UniRef50_Q9S7D6 Cluster: Putative RING zinc finger protein; 4311... 34 0.72 UniRef50_Q019G1 Cluster: Putative formamidopyrimidine-DNA glycos... 34 0.72 UniRef50_Q52P67 Cluster: BRCA1-like protein; n=40; Metatheria|Re... 34 0.72 UniRef50_Q8I5Z0 Cluster: Putative uncharacterized protein; n=3; ... 34 0.72 UniRef50_Q7RNQ0 Cluster: Zinc finger protein-related; n=2; Plasm... 34 0.72 UniRef50_Q5CZ24 Cluster: Ring domain-containing protein; n=2; Cr... 34 0.72 UniRef50_Q57TS8 Cluster: Putative uncharacterized protein; n=3; ... 34 0.72 UniRef50_Q4XCU2 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_Q4U9F6 Cluster: Putative uncharacterized protein; n=2; ... 34 0.72 UniRef50_Q4N0Y5 Cluster: Putative uncharacterized protein; n=2; ... 34 0.72 UniRef50_Q22NC9 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_Q179Y9 Cluster: Peroxisomal membrane protein, putative;... 34 0.72 UniRef50_A7SM27 Cluster: Predicted protein; n=1; Nematostella ve... 34 0.72 UniRef50_A7RMQ9 Cluster: Predicted protein; n=1; Nematostella ve... 34 0.72 UniRef50_A7RJK8 Cluster: Predicted protein; n=1; Nematostella ve... 34 0.72 UniRef50_A5K5X7 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_A5K0F4 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_A3FQ71 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_Q59ZW7 Cluster: Potential IBR-type zinc finger protein;... 34 0.72 UniRef50_Q59UR0 Cluster: Potential peroxisomal import complex pr... 34 0.72 UniRef50_Q4P4M5 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_A7TLT9 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_A7TGN5 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_A5DPA2 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_A5DFN2 Cluster: Putative uncharacterized protein; n=1; ... 34 0.72 UniRef50_A2QPJ8 Cluster: Similarity: contains a RING-type; n=1; ... 34 0.72 UniRef50_Q9C037 Cluster: Tripartite motif-containing protein 4; ... 34 0.72 UniRef50_Q14258 Cluster: Tripartite motif-containing protein 25;... 34 0.72 UniRef50_Q9Y4K3 Cluster: TNF receptor-associated factor 6; n=18;... 34 0.72 UniRef50_Q96A37 Cluster: RING finger protein 166; n=21; Euteleos... 34 0.72 UniRef50_Q9UUF0 Cluster: Peroxisome assembly protein 10; n=1; Sc... 34 0.72 UniRef50_Q6FXX1 Cluster: Pre-mRNA-splicing factor CWC24; n=1; Ca... 34 0.72 UniRef50_UPI00015B42F6 Cluster: PREDICTED: similar to ENSANGP000... 33 0.95 UniRef50_UPI000155C78F Cluster: PREDICTED: similar to ring finge... 33 0.95 UniRef50_UPI0000F214F9 Cluster: PREDICTED: hypothetical protein;... 33 0.95 UniRef50_UPI0000E81292 Cluster: PREDICTED: similar to Tripartite... 33 0.95 UniRef50_UPI0000DB6B6F Cluster: PREDICTED: similar to citrate sy... 33 0.95 UniRef50_UPI000054907C Cluster: PREDICTED: similar to bloodthirs... 33 0.95 UniRef50_UPI00015A7E12 Cluster: UPI00015A7E12 related cluster; n... 33 0.95 UniRef50_UPI00015A58A0 Cluster: hypothetical protein LOC678629; ... 33 0.95 UniRef50_UPI00015A588B Cluster: hypothetical protein LOC678629; ... 33 0.95 UniRef50_UPI00015A5889 Cluster: hypothetical protein LOC678629; ... 33 0.95 UniRef50_UPI0000500D07 Cluster: tripartite motif protein 11; n=3... 33 0.95 UniRef50_Q90Z51 Cluster: Breast and ovarian cancer susceptibilit... 33 0.95 UniRef50_Q90X96 Cluster: Breast and ovarian cancer susceptibilit... 33 0.95 UniRef50_Q7SXX1 Cluster: TNF receptor-associated factor 6; n=14;... 33 0.95 UniRef50_Q4T8D6 Cluster: Chromosome undetermined SCAF7829, whole... 33 0.95 UniRef50_Q4RL22 Cluster: Chromosome undetermined SCAF15024, whol... 33 0.95 UniRef50_Q5BIZ7 Cluster: Trim47_predicted protein; n=10; Theria|... 33 0.95 UniRef50_Q9LPR7 Cluster: F11F12.23 protein; n=4; Arabidopsis tha... 33 0.95 UniRef50_Q9AS72 Cluster: P0028E10.20 protein; n=2; Magnoliophyta... 33 0.95 UniRef50_Q25A47 Cluster: H0323C08.5 protein; n=4; Oryza sativa|R... 33 0.95 UniRef50_Q0DJ87 Cluster: Os05g0316000 protein; n=5; Magnoliophyt... 33 0.95 UniRef50_A3B2J1 Cluster: Putative uncharacterized protein; n=3; ... 33 0.95 UniRef50_Q8IID0 Cluster: Putative uncharacterized protein; n=4; ... 33 0.95 UniRef50_Q6IGI4 Cluster: HDC06237; n=1; Drosophila melanogaster|... 33 0.95 UniRef50_Q5DF60 Cluster: SJCHGC08969 protein; n=1; Schistosoma j... 33 0.95 UniRef50_Q55DN7 Cluster: Putative uncharacterized protein; n=1; ... 33 0.95 UniRef50_Q4CZE8 Cluster: Putative uncharacterized protein; n=2; ... 33 0.95 UniRef50_Q19214 Cluster: Putative uncharacterized protein; n=2; ... 33 0.95 UniRef50_A7RKF3 Cluster: Predicted protein; n=1; Nematostella ve... 33 0.95 UniRef50_A0C1N2 Cluster: Chromosome undetermined scaffold_142, w... 33 0.95 UniRef50_Q9P3U8 Cluster: Ubiquitin-protein ligase E3; n=1; Schiz... 33 0.95 UniRef50_Q5W5A3 Cluster: CrgA protein; n=2; Mucorales|Rep: CrgA ... 33 0.95 UniRef50_Q5B0G9 Cluster: Putative uncharacterized protein; n=1; ... 33 0.95 UniRef50_Q000Q5 Cluster: RING-15 protein; n=4; Sordariomycetes|R... 33 0.95 UniRef50_Q03605 Cluster: Uncharacterized RING finger protein T02... 33 0.95 UniRef50_Q8N9V2 Cluster: Tripartite motif family-like protein 1;... 33 0.95 UniRef50_Q6ZMU5 Cluster: Tripartite motif-containing protein 72;... 33 0.95 UniRef50_Q96BQ3 Cluster: Tripartite motif-containing protein 43;... 33 0.95 UniRef50_Q9Y577 Cluster: Tripartite motif-containing protein 17;... 33 0.95 UniRef50_Q96F44 Cluster: Tripartite motif-containing protein 11;... 33 0.95 UniRef50_P19474 Cluster: 52 kDa Ro protein (Sjoegren syndrome ty... 33 0.95 UniRef50_Q03601 Cluster: RING finger protein nhl-1; n=2; Caenorh... 33 0.95 UniRef50_Q8TBB1 Cluster: E3 ubiquitin-protein ligase LNX; n=30; ... 33 0.95 UniRef50_Q5ACW2 Cluster: Pre-mRNA-splicing factor CWC24; n=1; Ca... 33 0.95 UniRef50_P48754 Cluster: Breast cancer type 1 susceptibility pro... 33 0.95 UniRef50_P38398 Cluster: Breast cancer type 1 susceptibility pro... 33 0.95 UniRef50_Q9NZS9 Cluster: Bifunctional apoptosis regulator; n=21;... 33 0.95 UniRef50_UPI00015B439E Cluster: PREDICTED: similar to conserved ... 33 1.3 UniRef50_UPI0001556390 Cluster: PREDICTED: similar to LOC526787 ... 33 1.3 UniRef50_UPI0001554E06 Cluster: PREDICTED: hypothetical protein;... 33 1.3 UniRef50_UPI0000F1F690 Cluster: PREDICTED: similar to bloodthirs... 33 1.3 UniRef50_UPI0000E48A49 Cluster: PREDICTED: hypothetical protein;... 33 1.3 UniRef50_UPI0000D55C72 Cluster: PREDICTED: similar to CG10961-PA... 33 1.3 UniRef50_UPI0000D555A7 Cluster: PREDICTED: similar to CG7864-PA;... 33 1.3 UniRef50_UPI00006CCFA7 Cluster: hypothetical protein TTHERM_0018... 33 1.3 UniRef50_UPI00015A558E Cluster: UPI00015A558E related cluster; n... 33 1.3 UniRef50_UPI00015A4DF2 Cluster: UPI00015A4DF2 related cluster; n... 33 1.3 UniRef50_UPI00006A1B34 Cluster: Tripartite motif protein 50A.; n... 33 1.3 UniRef50_UPI00006A1B30 Cluster: Tripartite motif protein 50A.; n... 33 1.3 UniRef50_UPI000069FE1E Cluster: UPI000069FE1E related cluster; n... 33 1.3 UniRef50_UPI000069DEEA Cluster: UPI000069DEEA related cluster; n... 33 1.3 UniRef50_UPI000065E902 Cluster: Homolog of Homo sapiens "Tripart... 33 1.3 UniRef50_Q8CBG9-3 Cluster: Isoform 3 of Q8CBG9 ; n=3; Mus muscul... 33 1.3 UniRef50_Q6GNH8 Cluster: LOC443658 protein; n=6; Xenopus|Rep: LO... 33 1.3 UniRef50_Q4SQS1 Cluster: Chromosome undetermined SCAF14531, whol... 33 1.3 UniRef50_Q4SJQ1 Cluster: Chromosome 1 SCAF14573, whole genome sh... 33 1.3 UniRef50_Q4SB78 Cluster: Chromosome undetermined SCAF14677, whol... 33 1.3 UniRef50_Q4RE24 Cluster: Chromosome 10 SCAF15143, whole genome s... 33 1.3 UniRef50_Q498C4 Cluster: LOC733334 protein; n=1; Xenopus laevis|... 33 1.3 UniRef50_Q019Z0 Cluster: Transcription factor TCF20; n=1; Ostreo... 33 1.3 UniRef50_A7QAB4 Cluster: Chromosome undetermined scaffold_70, wh... 33 1.3 UniRef50_A7Q1A3 Cluster: Chromosome chr10 scaffold_43, whole gen... 33 1.3 UniRef50_Q5BU71 Cluster: Tripartite motif protein L-TRIM; n=1; L... 33 1.3 UniRef50_Q54WX3 Cluster: Putative uncharacterized protein; n=1; ... 33 1.3 UniRef50_Q4Q938 Cluster: Putative uncharacterized protein; n=3; ... 33 1.3 UniRef50_Q299J8 Cluster: GA10686-PA; n=1; Drosophila pseudoobscu... 33 1.3 UniRef50_Q16V14 Cluster: Putative uncharacterized protein; n=2; ... 33 1.3 UniRef50_O61858 Cluster: Putative uncharacterized protein; n=2; ... 33 1.3 UniRef50_A7SPQ3 Cluster: Predicted protein; n=1; Nematostella ve... 33 1.3 UniRef50_A4F321 Cluster: Putative uncharacterized protein; n=1; ... 33 1.3 UniRef50_A2EYD0 Cluster: Putative uncharacterized protein; n=1; ... 33 1.3 UniRef50_A2D8J3 Cluster: Putative uncharacterized protein; n=1; ... 33 1.3 UniRef50_A0C9B0 Cluster: Chromosome undetermined scaffold_16, wh... 33 1.3 UniRef50_Q6CMY8 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 33 1.3 UniRef50_Q4X1C3 Cluster: ATP-dependent protease (CrgA), putative... 33 1.3 UniRef50_Q0CWC8 Cluster: Predicted protein; n=1; Aspergillus ter... 33 1.3 UniRef50_A5DKI1 Cluster: Putative uncharacterized protein; n=1; ... 33 1.3 UniRef50_A2R5Z8 Cluster: Similarity: mouse TRAF5 is member of th... 33 1.3 UniRef50_Q5UPZ3 Cluster: Putative RING finger protein R311; n=1;... 33 1.3 UniRef50_Q9BVG3 Cluster: Tripartite motif-containing protein 62;... 33 1.3 UniRef50_P14373 Cluster: Zinc finger protein RFP; n=20; Eutheria... 33 1.3 UniRef50_Q32NQ8 Cluster: RING finger protein 10; n=4; Euteleosto... 33 1.3 UniRef50_Q6FPI4 Cluster: Postreplication repair E3 ubiquitin-pro... 33 1.3 UniRef50_UPI00015B5F2C Cluster: PREDICTED: similar to breast and... 33 1.7 UniRef50_UPI000155D29A Cluster: PREDICTED: similar to SSA1; n=1;... 33 1.7 UniRef50_UPI0000F2E98D Cluster: PREDICTED: hypothetical protein;... 33 1.7 UniRef50_UPI0000F2C0E1 Cluster: PREDICTED: similar to Tripartite... 33 1.7 UniRef50_UPI0000F20734 Cluster: PREDICTED: similar to bloodthirs... 33 1.7 UniRef50_UPI0000E4A07F Cluster: PREDICTED: similar to ribosomal ... 33 1.7 UniRef50_UPI0000E4956B Cluster: PREDICTED: similar to PTD016 pro... 33 1.7 UniRef50_UPI0000E475A1 Cluster: PREDICTED: similar to ubiquitin;... 33 1.7 UniRef50_UPI0000E45D69 Cluster: PREDICTED: hypothetical protein,... 33 1.7 UniRef50_UPI0000E205ED Cluster: PREDICTED: tripartite motif-cont... 33 1.7 UniRef50_UPI0000DA2D72 Cluster: PREDICTED: similar to PDZ domain... 33 1.7 UniRef50_UPI0000498711 Cluster: hypothetical protein 200.t00011;... 33 1.7 UniRef50_UPI000023F28A Cluster: hypothetical protein FG05582.1; ... 33 1.7 UniRef50_UPI00015A53F9 Cluster: UPI00015A53F9 related cluster; n... 33 1.7 UniRef50_UPI0000EB26AF Cluster: Tripartite motif-containing prot... 33 1.7 UniRef50_Q7T290 Cluster: Zgc:64214; n=5; Danio rerio|Rep: Zgc:64... 33 1.7 UniRef50_Q640F7 Cluster: LOC494681 protein; n=166; Xenopus|Rep: ... 33 1.7 UniRef50_Q63ZP0 Cluster: LOC494766 protein; n=1; Xenopus laevis|... 33 1.7 UniRef50_Q4V8S4 Cluster: Zgc:136302 protein; n=15; Danio rerio|R... 33 1.7 UniRef50_Q4SML6 Cluster: Chromosome 18 SCAF14547, whole genome s... 33 1.7 UniRef50_Q4SJ95 Cluster: Chromosome 4 SCAF14575, whole genome sh... 33 1.7 UniRef50_Q0P4C3 Cluster: Zgc:153151; n=2; Danio rerio|Rep: Zgc:1... 33 1.7 UniRef50_Q08D14 Cluster: LOC779579 protein; n=1; Xenopus tropica... 33 1.7 UniRef50_Q54YN7 Cluster: Putative uncharacterized protein; n=1; ... 33 1.7 >UniRef50_UPI0000D5735E Cluster: PREDICTED: similar to ring finger protein 146 (predicted); n=1; Tribolium castaneum|Rep: PREDICTED: similar to ring finger protein 146 (predicted) - Tribolium castaneum Length = 235 Score = 57.2 bits (132), Expect = 7e-08 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +CAVCLQ C HP +L CGH+FCFLCVK Sbjct: 26 ECAVCLQNCVHPAQLPCGHIFCFLCVK 52 >UniRef50_Q17EU4 Cluster: Ring finger protein; n=1; Aedes aegypti|Rep: Ring finger protein - Aedes aegypti (Yellowfever mosquito) Length = 348 Score = 55.6 bits (128), Expect = 2e-07 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++ +C VCLQ C HP +L CGHVFCFLCVK Sbjct: 50 VKMECPVCLQTCIHPARLPCGHVFCFLCVK 79 >UniRef50_UPI0000E4A6E8 Cluster: PREDICTED: hypothetical protein, partial; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein, partial - Strongylocentrotus purpuratus Length = 537 Score = 55.2 bits (127), Expect = 3e-07 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 DCAVCLQ C HP +L C HVFCFLC+K Sbjct: 14 DCAVCLQTCVHPVELPCSHVFCFLCMK 40 >UniRef50_Q9VW25 Cluster: CG8786-PB; n=3; Diptera|Rep: CG8786-PB - Drosophila melanogaster (Fruit fly) Length = 376 Score = 54.4 bits (125), Expect = 5e-07 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +C +CLQ C HP +L CGH+FCFLCVK Sbjct: 123 ECPICLQTCIHPARLPCGHIFCFLCVK 149 >UniRef50_UPI00015B5EC7 Cluster: PREDICTED: similar to rCG42109; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to rCG42109 - Nasonia vitripennis Length = 327 Score = 53.2 bits (122), Expect = 1e-06 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +CAVCLQ C HP +L C HVFC+LCVK Sbjct: 38 ECAVCLQLCIHPARLPCNHVFCYLCVK 64 >UniRef50_Q7ZUK0 Cluster: Ring finger protein 146; n=3; Clupeocephala|Rep: Ring finger protein 146 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 364 Score = 52.0 bits (119), Expect = 3e-06 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +C +CLQ C HP +L C H+FCFLCVK Sbjct: 41 ECPICLQSCVHPVRLPCRHIFCFLCVK 67 >UniRef50_Q9NTX7 Cluster: RING finger protein 146; n=28; Eumetazoa|Rep: RING finger protein 146 - Homo sapiens (Human) Length = 359 Score = 52.0 bits (119), Expect = 3e-06 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +CA+CLQ C HP L C HVFC+LCVK Sbjct: 36 ECAICLQTCVHPVSLPCKHVFCYLCVK 62 >UniRef50_Q5DDM0 Cluster: SJCHGC09082 protein; n=2; Schistosoma japonicum|Rep: SJCHGC09082 protein - Schistosoma japonicum (Blood fluke) Length = 291 Score = 50.4 bits (115), Expect = 8e-06 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +C++CLQ HP +L CGH+FCFLC+K Sbjct: 7 ECSICLQNFIHPAQLPCGHIFCFLCIK 33 >UniRef50_UPI0000519B18 Cluster: PREDICTED: similar to ring finger protein 146; n=1; Apis mellifera|Rep: PREDICTED: similar to ring finger protein 146 - Apis mellifera Length = 287 Score = 49.6 bits (113), Expect = 1e-05 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +CAVCLQ C +P +L C H++C+LCVK Sbjct: 34 ECAVCLQPCIYPARLPCNHIYCYLCVK 60 >UniRef50_UPI000023E27B Cluster: hypothetical protein FG07753.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG07753.1 - Gibberella zeae PH-1 Length = 781 Score = 43.6 bits (98), Expect = 9e-04 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = +1 Query: 142 DNLCVLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLC 273 D V + AV + + N+E DC+VC + + + SCGH++C +C Sbjct: 552 DGHAVKETAVPVKTKNLETDCSVCFGEAEESLETSCGHIYCNIC 595 >UniRef50_Q5RIK0 Cluster: Novel protein; n=7; Danio rerio|Rep: Novel protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 341 Score = 42.3 bits (95), Expect = 0.002 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 166 AVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 A +I +N +Y C+VCL + P + CGH +C C+ Sbjct: 2 AEIILENNDQYSCSVCLDLLKDPVTIPCGHSYCMSCI 38 >UniRef50_Q96EQ8 Cluster: E3 ubiquitin-protein ligase RNF125; n=16; Theria|Rep: E3 ubiquitin-protein ligase RNF125 - Homo sapiens (Human) Length = 232 Score = 41.9 bits (94), Expect = 0.003 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +DCAVCL+ P + CGHVFC C+ Sbjct: 35 FDCAVCLEVLHQPVRTRCGHVFCRSCI 61 >UniRef50_Q9SYU4 Cluster: Peroxisome assembly protein 10; n=5; Magnoliophyta|Rep: Peroxisome assembly protein 10 - Arabidopsis thaliana (Mouse-ear cress) Length = 381 Score = 41.9 bits (94), Expect = 0.003 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL QHPT CGHVFC+ C+ Sbjct: 327 CTLCLSTRQHPTATPCGHVFCWSCI 351 >UniRef50_UPI00001C46D6 Cluster: PREDICTED: similar to Ret finger protein-like 4B; n=1; Mus musculus|Rep: PREDICTED: similar to Ret finger protein-like 4B - Mus musculus Length = 266 Score = 41.5 bits (93), Expect = 0.004 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ME CA+CL HP LSC H+ CF C K Sbjct: 27 MEATCAICLDIYSHPIYLSCAHILCFDCGK 56 >UniRef50_UPI00005A581F Cluster: PREDICTED: similar to Tripartite motif protein 38 (RING finger protein 15) (Zinc finger protein RoRet); n=1; Canis lupus familiaris|Rep: PREDICTED: similar to Tripartite motif protein 38 (RING finger protein 15) (Zinc finger protein RoRet) - Canis familiaris Length = 569 Score = 41.1 bits (92), Expect = 0.005 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E CA+CLQ P +SCGH +C LC+ Sbjct: 13 EATCAICLQLMSEPMSISCGHSYCTLCI 40 >UniRef50_Q2QUC7 Cluster: Zinc finger, C3HC4 type family protein, expressed; n=2; Oryza sativa|Rep: Zinc finger, C3HC4 type family protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 391 Score = 41.1 bits (92), Expect = 0.005 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E CA+CL+ C P+ CGH FC C+K Sbjct: 161 ELSCAICLEICFEPSTTPCGHSFCMKCLK 189 >UniRef50_Q60PN3 Cluster: Putative uncharacterized protein CBG22172; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG22172 - Caenorhabditis briggsae Length = 300 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +1 Query: 202 CAVCLQKCQHPTKLS-CGHVFCFLCVKV*NIL 294 CAVC PT++ CGH+FCFLC+K IL Sbjct: 122 CAVCYDPSTIPTRIEKCGHIFCFLCLKTNYIL 153 >UniRef50_A0CIY1 Cluster: Chromosome undetermined scaffold_19, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_19, whole genome shotgun sequence - Paramecium tetraurelia Length = 410 Score = 41.1 bits (92), Expect = 0.005 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C++CLQ + P LSCGH FC C++ Sbjct: 7 CSICLQNLKSPVSLSCGHTFCQTCIQ 32 >UniRef50_A0BVZ1 Cluster: Chromosome undetermined scaffold_130, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_130, whole genome shotgun sequence - Paramecium tetraurelia Length = 440 Score = 41.1 bits (92), Expect = 0.005 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +E++C +CL PT LSCGH FC C+ Sbjct: 4 IEFNCTICLNHLSDPTCLSCGHSFCEKCI 32 >UniRef50_A0D8C6 Cluster: Chromosome undetermined scaffold_401, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_401, whole genome shotgun sequence - Paramecium tetraurelia Length = 137 Score = 40.7 bits (91), Expect = 0.006 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +DC +CLQ P L+CGH FC CV+ Sbjct: 31 FDCPICLQTLLQPITLTCGHTFCKPCVR 58 >UniRef50_A0CBY0 Cluster: Chromosome undetermined scaffold_165, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_165, whole genome shotgun sequence - Paramecium tetraurelia Length = 207 Score = 40.7 bits (91), Expect = 0.006 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +DC +CLQ P L+CGH FC CV+ Sbjct: 5 FDCPICLQTLLQPITLTCGHTFCKPCVR 32 >UniRef50_O60683-2 Cluster: Isoform 2 of O60683 ; n=5; Theria|Rep: Isoform 2 of O60683 - Homo sapiens (Human) Length = 346 Score = 40.3 bits (90), Expect = 0.008 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL++ +HPT CGH+FC+ C+ Sbjct: 293 CTLCLEERRHPTATPCGHLFCWECI 317 >UniRef50_O60683 Cluster: Peroxisome assembly protein 10; n=18; Euteleostomi|Rep: Peroxisome assembly protein 10 - Homo sapiens (Human) Length = 326 Score = 40.3 bits (90), Expect = 0.008 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL++ +HPT CGH+FC+ C+ Sbjct: 273 CTLCLEERRHPTATPCGHLFCWECI 297 >UniRef50_UPI0000F21335 Cluster: PREDICTED: similar to bloodthirsty; n=6; Danio rerio|Rep: PREDICTED: similar to bloodthirsty - Danio rerio Length = 551 Score = 39.9 bits (89), Expect = 0.011 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + C+VCL HP L CGH FC CV Sbjct: 13 FQCSVCLDVFTHPVSLPCGHTFCQSCV 39 >UniRef50_A4RWX9 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 619 Score = 39.9 bits (89), Expect = 0.011 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 CAVCL + PTKL+C H FC C K Sbjct: 27 CAVCLSLPKKPTKLACSHYFCAACAK 52 >UniRef50_Q4QIQ6 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 923 Score = 39.9 bits (89), Expect = 0.011 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +1 Query: 169 VLIFSHNMEYD--CAVCLQKCQHPTKLSCGHVFCFLCVK 279 V++ H D C VC+ C+ PT +CGH+FC C++ Sbjct: 386 VIVDPHQAPDDLVCGVCMSVCRQPTAAACGHLFCRRCLQ 424 >UniRef50_Q4N154 Cluster: Putative uncharacterized protein; n=2; Theileria|Rep: Putative uncharacterized protein - Theileria parva Length = 284 Score = 39.9 bits (89), Expect = 0.011 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +1 Query: 181 SHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVKV*NILLFFLNKRN 318 S N +++C +C + + P CGH+FC+ C LL ++N+RN Sbjct: 16 SPNSKFECNICFDEVKDPVVTRCGHLFCWSC------LLSWMNRRN 55 >UniRef50_Q4DP57 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 807 Score = 39.9 bits (89), Expect = 0.011 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 196 YDCAVCLQKCQHP-TKLSCGHVFCFLCV 276 Y C +CLQ C++P T + CGH FC C+ Sbjct: 719 YSCGICLQVCRNPLTCVPCGHTFCEFCL 746 >UniRef50_A5DGM2 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 466 Score = 39.9 bits (89), Expect = 0.011 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 154 VLKHAVLIFSHNME-YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 V++ ++L +E + C +CL P KL+CGHVFC C+ Sbjct: 357 VIQSSILKLVPQLEDFTCPICLSIAYKPIKLNCGHVFCVRCL 398 >UniRef50_A3LX14 Cluster: Predicted protein; n=2; Saccharomycetaceae|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 496 Score = 39.9 bits (89), Expect = 0.011 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +1 Query: 145 NLC-VLKHAVLIFSHNME-YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +L++ VL +E Y C +C+ P +L CGH+FC C+ Sbjct: 396 SICYILQNRVLTLIPQLEDYTCPICMSIAYKPIRLQCGHLFCVRCL 441 >UniRef50_Q9LTZ6 Cluster: Arabidopsis thaliana genomic DNA, chromosome 3, TAC clone:K1G2; n=10; Magnoliophyta|Rep: Arabidopsis thaliana genomic DNA, chromosome 3, TAC clone:K1G2 - Arabidopsis thaliana (Mouse-ear cress) Length = 354 Score = 39.5 bits (88), Expect = 0.014 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E CA+CL+ C P+ +CGH FC C++ Sbjct: 162 ELSCAICLEICFEPSTTTCGHSFCKKCLR 190 >UniRef50_A7S5K6 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 295 Score = 39.5 bits (88), Expect = 0.014 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C++CL+ +H T SCGH+FC+ C+ Sbjct: 242 CSLCLENVKHITSTSCGHLFCWHCI 266 >UniRef50_Q5A1M4 Cluster: Potential zinc RING finger protein; n=2; Saccharomycetales|Rep: Potential zinc RING finger protein - Candida albicans (Yeast) Length = 494 Score = 39.5 bits (88), Expect = 0.014 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +Y C +C+ P +LSCGH+FC C+ Sbjct: 395 DYSCPICMNIAYKPIRLSCGHLFCVRCL 422 >UniRef50_UPI00015A6700 Cluster: hypothetical protein LOC793961 (LOC793961), mRNA; n=2; Danio rerio|Rep: hypothetical protein LOC793961 (LOC793961), mRNA - Danio rerio Length = 362 Score = 39.1 bits (87), Expect = 0.019 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++C++CL+ + P SCGH FC C+K Sbjct: 19 FNCSICLELFKDPVTTSCGHSFCMNCIK 46 >UniRef50_Q08CC9 Cluster: Zgc:153258; n=7; Danio rerio|Rep: Zgc:153258 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 577 Score = 39.1 bits (87), Expect = 0.019 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C++CL + P L+CGH +C LC++ Sbjct: 9 FSCSICLDVLKDPATLACGHSYCLLCIQ 36 >UniRef50_Q6NLR3 Cluster: At2g44410; n=2; Arabidopsis thaliana|Rep: At2g44410 - Arabidopsis thaliana (Mouse-ear cress) Length = 413 Score = 39.1 bits (87), Expect = 0.019 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLC 273 +DC +CL+K + P CGH+FC+ C Sbjct: 123 FDCNICLEKAEDPILTCCGHLFCWGC 148 >UniRef50_Q00WB9 Cluster: Pex10p; n=2; Ostreococcus|Rep: Pex10p - Ostreococcus tauri Length = 402 Score = 39.1 bits (87), Expect = 0.019 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+CL + + PT CGHVFC+ CV Sbjct: 347 CALCLSQRRAPTATPCGHVFCWRCV 371 >UniRef50_O64425 Cluster: RMA1 protein; n=1; Arabidopsis thaliana|Rep: RMA1 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 249 Score = 39.1 bits (87), Expect = 0.019 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +DC +CL Q P CGH+FC+ C+ Sbjct: 46 FDCNICLDSVQEPVVTLCGHLFCWPCI 72 >UniRef50_Q8WQB0 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 224 Score = 39.1 bits (87), Expect = 0.019 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKL-SCGHVFCFLCVK 279 ++ +CAVC + PT + SCGH FCF+C+K Sbjct: 20 IDKECAVCYSEMILPTTIPSCGHKFCFICLK 50 >UniRef50_Q57WU1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 1541 Score = 39.1 bits (87), Expect = 0.019 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCV 276 +CA+CL HPT LSC H+FC C+ Sbjct: 1237 ECAICLDTMLHPTLLSCFHLFCKECL 1262 >UniRef50_A7T4K5 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 407 Score = 39.1 bits (87), Expect = 0.019 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +Y+C +CL + P + CGH FCF C++ Sbjct: 375 KYECPICLLGLRDPVQTPCGHRFCFNCIR 403 >UniRef50_A7RI91 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 482 Score = 39.1 bits (87), Expect = 0.019 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +Y+C +CL + P + CGH FCF C++ Sbjct: 55 KYECPICLLGLRDPVQTPCGHRFCFNCIR 83 >UniRef50_Q875B4 Cluster: Putative uncharacterized protein Pa5D0011; n=3; Sordariales|Rep: Putative uncharacterized protein Pa5D0011 - Podospora anserina Length = 461 Score = 39.1 bits (87), Expect = 0.019 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++Y C VCL C P +L C H+FC C+ Sbjct: 339 VDYTCIVCLSICWLPIRLDCDHLFCIRCM 367 >UniRef50_UPI000155BACC Cluster: PREDICTED: similar to ZNF173; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to ZNF173 - Ornithorhynchus anatinus Length = 585 Score = 38.7 bits (86), Expect = 0.025 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 E C VC+ + P + CGH+FC CVKV Sbjct: 12 EVKCPVCMSYLKDPIFIDCGHIFCRRCVKV 41 >UniRef50_UPI0001556217 Cluster: PREDICTED: similar to RET finger protein-like 3, partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to RET finger protein-like 3, partial - Ornithorhynchus anatinus Length = 308 Score = 38.7 bits (86), Expect = 0.025 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C VCL +PT + CGH FC C+ Sbjct: 11 EVICPVCLDYFSYPTSIECGHTFCLSCI 38 >UniRef50_A4IG09 Cluster: Si:dkey-7b17.2 protein; n=25; Clupeocephala|Rep: Si:dkey-7b17.2 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 576 Score = 38.7 bits (86), Expect = 0.025 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +1 Query: 190 MEYD---CAVCLQKCQHPTKLSCGHVFCFLCVK 279 M YD C +C + + P + CGHVFC LC+K Sbjct: 1 MSYDQDLCYLCKEDFRDPVSIPCGHVFCSLCIK 33 >UniRef50_Q9SRX9 Cluster: F22D16.14 protein; n=2; Arabidopsis thaliana|Rep: F22D16.14 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 335 Score = 38.7 bits (86), Expect = 0.025 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +1 Query: 151 CVLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLC 273 C L +V + +++ C++CL P L+CGH++C++C Sbjct: 217 CELSDSVKV---DIDLTCSICLDTVFDPISLTCGHIYCYMC 254 >UniRef50_Q86L97 Cluster: Similar to Arabidopsis thaliana (Mouse-ear cress). DNA repair protein RAD5 protein; n=2; Dictyostelium discoideum|Rep: Similar to Arabidopsis thaliana (Mouse-ear cress). DNA repair protein RAD5 protein - Dictyostelium discoideum (Slime mold) Length = 604 Score = 38.7 bits (86), Expect = 0.025 Identities = 10/29 (34%), Positives = 21/29 (72%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + +C +C++ ++P+ +CGH FC LC++ Sbjct: 132 DQECTICMETLENPSITTCGHFFCTLCIQ 160 >UniRef50_UPI0000F2DA65 Cluster: PREDICTED: similar to zinc finger protein 179,; n=3; Monodelphis domestica|Rep: PREDICTED: similar to zinc finger protein 179, - Monodelphis domestica Length = 644 Score = 38.3 bits (85), Expect = 0.033 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E +C++CL+ Q P + CGH FC C+ Sbjct: 97 ELNCSICLELFQDPVSIECGHNFCAQCI 124 >UniRef50_UPI0000F2108D Cluster: PREDICTED: similar to RING finger protein; n=2; Danio rerio|Rep: PREDICTED: similar to RING finger protein - Danio rerio Length = 540 Score = 38.3 bits (85), Expect = 0.033 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +E C +CLQ + P L CGH +C C+K Sbjct: 12 LELSCPICLQLFRDPVALPCGHNYCLGCIK 41 >UniRef50_UPI00005844F3 Cluster: PREDICTED: similar to apoptosis regulator; n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to apoptosis regulator - Strongylocentrotus purpuratus Length = 488 Score = 38.3 bits (85), Expect = 0.033 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 175 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + S + + CA C + PT L+CGH FC LC+ Sbjct: 73 VSSLDSNFSCACCYELMVQPTTLNCGHSFCRLCL 106 >UniRef50_UPI00006A0E29 Cluster: Zinc finger protein 179 (Brain finger protein) (RING finger protein 112).; n=1; Xenopus tropicalis|Rep: Zinc finger protein 179 (Brain finger protein) (RING finger protein 112). - Xenopus tropicalis Length = 596 Score = 38.3 bits (85), Expect = 0.033 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +1 Query: 184 HNMEYD--CAVCLQKCQHPTKLSCGHVFCFLCV 276 H +E D C+VCL + P ++CGH FC C+ Sbjct: 49 HKLEEDITCSVCLSELTDPVSITCGHTFCRNCI 81 >UniRef50_UPI0000ECB384 Cluster: UPI0000ECB384 related cluster; n=1; Gallus gallus|Rep: UPI0000ECB384 UniRef100 entry - Gallus gallus Length = 138 Score = 38.3 bits (85), Expect = 0.033 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +1 Query: 181 SHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 S++ ++ C +CLQ P + +CGH+FC C+ Sbjct: 12 SNHSDFSCPICLQTVTLPVETNCGHLFCGSCL 43 >UniRef50_Q6K9N9 Cluster: Putative PRT1 protein; n=3; Oryza sativa|Rep: Putative PRT1 protein - Oryza sativa subsp. japonica (Rice) Length = 408 Score = 38.3 bits (85), Expect = 0.033 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ + C VCL+ P ++CGH+ CF CV Sbjct: 39 DLRFQCCVCLELLYKPVVIACGHMSCFWCV 68 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + CA+C + P L+CGHV+C C+ Sbjct: 178 DVSCALCKELLYQPAVLNCGHVYCMSCL 205 >UniRef50_P93030 Cluster: RING zinc finger protein; n=1; Arabidopsis thaliana|Rep: RING zinc finger protein - Arabidopsis thaliana (Mouse-ear cress) Length = 193 Score = 38.3 bits (85), Expect = 0.033 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++DC +CL + + P CGH+FC+ C+ Sbjct: 18 DFDCNICLDQVRDPVVTLCGHLFCWPCI 45 >UniRef50_Q9XWM0 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 283 Score = 38.3 bits (85), Expect = 0.033 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 184 HNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 H ++C +CL P CGH+FC C+ Sbjct: 99 HQSSHECPICLANASFPVLTDCGHIFCCECI 129 >UniRef50_Q7R1C3 Cluster: GLP_306_45927_45298; n=1; Giardia lamblia ATCC 50803|Rep: GLP_306_45927_45298 - Giardia lamblia ATCC 50803 Length = 209 Score = 38.3 bits (85), Expect = 0.033 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 E+ C +C+ +P CGH++C+ C+K+ Sbjct: 13 EFACPICMSDPNYPVLTQCGHIYCYSCLKL 42 >UniRef50_Q7QQF6 Cluster: GLP_91_8176_7298; n=1; Giardia lamblia ATCC 50803|Rep: GLP_91_8176_7298 - Giardia lamblia ATCC 50803 Length = 292 Score = 38.3 bits (85), Expect = 0.033 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 CA+C HP L+CGHVFC CV+ Sbjct: 88 CAICYGLFSHPVVLTCGHVFCEGCVQ 113 >UniRef50_Q0UX22 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 379 Score = 38.3 bits (85), Expect = 0.033 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL++ + P+ +CGHVFC+ C+ Sbjct: 328 CTLCLEEMKDPSVTTCGHVFCWTCI 352 >UniRef50_Q86WT6 Cluster: Tripartite motif-containing protein 69; n=27; Theria|Rep: Tripartite motif-containing protein 69 - Homo sapiens (Human) Length = 500 Score = 38.3 bits (85), Expect = 0.033 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 112 SNLEMGR*V*--DNLCVLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 SN++ G V D++ L V+I ME C +C + P LSCGH FC C++ Sbjct: 9 SNIDPGNYVEMNDSITHLPSKVVIQDITMELHCPLCNDWFRDPLMLSCGHNFCEACIQ 66 >UniRef50_UPI00015563EB Cluster: PREDICTED: similar to Tripartite motif protein 39; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to Tripartite motif protein 39 - Ornithorhynchus anatinus Length = 243 Score = 37.9 bits (84), Expect = 0.044 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E CA+CLQ P ++CGH FC +C+ Sbjct: 11 ELTCAICLQFFMSPVTINCGHSFCQVCL 38 >UniRef50_UPI0001554FA4 Cluster: PREDICTED: similar to tripartite motif-containing 10; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to tripartite motif-containing 10 - Ornithorhynchus anatinus Length = 537 Score = 37.9 bits (84), Expect = 0.044 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E CA+CL + P + CGH+FC CV Sbjct: 12 EVTCAICLTYLEDPVTIDCGHIFCRGCV 39 >UniRef50_UPI0000F1F5F9 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 406 Score = 37.9 bits (84), Expect = 0.044 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 175 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 IF + ++ C +C+ + P + CGH +C C+K Sbjct: 8 IFVNQEQFSCPICMDLLRDPVTIPCGHNYCMECIK 42 >UniRef50_UPI0000E48C43 Cluster: PREDICTED: similar to helicase-like transcription factor, partial; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to helicase-like transcription factor, partial - Strongylocentrotus purpuratus Length = 64 Score = 37.9 bits (84), Expect = 0.044 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 169 VLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 V S + +C +CL+ Q P C HVFC C++ Sbjct: 21 VSFLSQGADEECCICLESVQDPVVTRCAHVFCQRCIE 57 >UniRef50_UPI0000545748 Cluster: PREDICTED: hypothetical protein; n=4; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 575 Score = 37.9 bits (84), Expect = 0.044 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E+ C++CL + P + CGH +C LC+ Sbjct: 39 EFCCSICLDLLKDPVAIPCGHSYCMLCI 66 >UniRef50_UPI00015A73E5 Cluster: UPI00015A73E5 related cluster; n=3; Danio rerio|Rep: UPI00015A73E5 UniRef100 entry - Danio rerio Length = 399 Score = 37.9 bits (84), Expect = 0.044 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 175 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 IF + ++ C +C+ + P + CGH +C C+K Sbjct: 6 IFVNQEQFSCPICMDLLRDPVTIPCGHNYCMECIK 40 >UniRef50_UPI0000F34814 Cluster: Tripartite motif-containing protein 5 (EC 6.3.2.-) (RING finger protein 88).; n=1; Bos taurus|Rep: Tripartite motif-containing protein 5 (EC 6.3.2.-) (RING finger protein 88). - Bos Taurus Length = 477 Score = 37.9 bits (84), Expect = 0.044 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 172 LIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVKV*NIL 294 ++ + E C +CL+ P L CGH FC C+ N++ Sbjct: 5 IVVNLQQEVTCPICLELLTEPLSLDCGHSFCQACITANNMV 45 >UniRef50_Q567F9 Cluster: Wu:fb13h06 protein; n=7; Danio rerio|Rep: Wu:fb13h06 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 431 Score = 37.9 bits (84), Expect = 0.044 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 175 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +F + +++C++CL + P + CGH +C C+K Sbjct: 13 VFLEHDQFNCSICLDVLKDPVTIPCGHSYCKGCIK 47 >UniRef50_Q9VJB0 Cluster: CG15150-PA; n=1; Drosophila melanogaster|Rep: CG15150-PA - Drosophila melanogaster (Fruit fly) Length = 187 Score = 37.9 bits (84), Expect = 0.044 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +1 Query: 190 MEYDCAVCLQKCQH--PTKLSCGHVFCFLCVK 279 + Y+C VCL+ + P +CGHVFC C+K Sbjct: 132 LPYNCPVCLEDVREKLPVSTNCGHVFCKACIK 163 >UniRef50_O17719 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 228 Score = 37.9 bits (84), Expect = 0.044 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKL-SCGHVFCFLCVK 279 N++ +C +C K PT + +CGH FCF+C+K Sbjct: 7 NIDAECPICQCKMIVPTTIPACGHKFCFICLK 38 >UniRef50_A2SVB5 Cluster: TRAF6; n=1; Chlamys farreri|Rep: TRAF6 - Chlamys farreri Length = 655 Score = 37.9 bits (84), Expect = 0.044 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +YDC +CL + P + CGH FC C+K Sbjct: 90 KYDCPICLLVLRDPYQTECGHRFCQNCIK 118 >UniRef50_A4QRH5 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 461 Score = 37.9 bits (84), Expect = 0.044 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 154 VLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 V H V +Y C +C+ P +L+C H+FC CV Sbjct: 350 VSNHVVSTVPRVEDYSCPICMSIAWLPVRLACRHIFCVRCV 390 >UniRef50_A2R1D2 Cluster: Contig An13c0040, complete genome; n=10; Pezizomycotina|Rep: Contig An13c0040, complete genome - Aspergillus niger Length = 378 Score = 37.9 bits (84), Expect = 0.044 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +CL+ + P+ +CGHVFC+ CV+ Sbjct: 327 CTLCLELFKDPSVTTCGHVFCWTCVR 352 >UniRef50_Q9Y508 Cluster: Zinc finger protein 313; n=29; Euteleostomi|Rep: Zinc finger protein 313 - Homo sapiens (Human) Length = 228 Score = 37.9 bits (84), Expect = 0.044 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C VCL+ + P ++ CGHVFC C++ Sbjct: 27 FTCPVCLEVYEKPVQVPCGHVFCSACLQ 54 >UniRef50_Q8LBL5 Cluster: E3 ubiquitin-protein ligase PRT1; n=1; Arabidopsis thaliana|Rep: E3 ubiquitin-protein ligase PRT1 - Arabidopsis thaliana (Mouse-ear cress) Length = 410 Score = 37.9 bits (84), Expect = 0.044 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ C VCL+ P LSCGH+ CF CV Sbjct: 23 QFLCCVCLELLYKPIVLSCGHLSCFWCV 50 Score = 31.9 bits (69), Expect = 2.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C+ C + P L+CGHV+C CV Sbjct: 192 CSACKELLVRPVVLNCGHVYCEGCV 216 >UniRef50_UPI0001556330 Cluster: PREDICTED: similar to hCG1811307; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to hCG1811307 - Ornithorhynchus anatinus Length = 262 Score = 37.5 bits (83), Expect = 0.058 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C VCL ++P ++CGH FC++C+ Sbjct: 12 EVTCPVCLDFFRNPVIIACGHSFCWICI 39 >UniRef50_Q7XI36 Cluster: Putative DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8; n=3; Oryza sativa|Rep: Putative DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 - Oryza sativa subsp. japonica (Rice) Length = 1686 Score = 37.5 bits (83), Expect = 0.058 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKL-SCGHVFCFLCV 276 +E C +CL + + P KL SCGHVFC C+ Sbjct: 1520 LENACPICLCEVEDPFKLESCGHVFCLTCL 1549 >UniRef50_A3A0Z1 Cluster: Putative uncharacterized protein; n=5; Magnoliophyta|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 280 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++C VC+ + P+ CGH+FC C+K Sbjct: 223 FNCPVCMNELVEPSSTICGHIFCKQCIK 250 >UniRef50_Q4QPY0 Cluster: IP05667p; n=1; Drosophila melanogaster|Rep: IP05667p - Drosophila melanogaster (Fruit fly) Length = 124 Score = 37.5 bits (83), Expect = 0.058 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA CL + Q+P KL C H FC C+ Sbjct: 40 CAFCLDRIQNPEKLHCNHAFCKSCL 64 >UniRef50_Q4Q1N0 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 300 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +++ CA+CL P CGH+FC+ C+ Sbjct: 9 VDFSCAICLDTATEPVVTRCGHLFCWECL 37 >UniRef50_A7AVG7 Cluster: Zinc finger protein, putative; n=1; Babesia bovis|Rep: Zinc finger protein, putative - Babesia bovis Length = 859 Score = 37.5 bits (83), Expect = 0.058 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C++CL HP L CGH FC C+ Sbjct: 374 CSICLDYFYHPVTLFCGHTFCRYCI 398 >UniRef50_A2TK70 Cluster: Tumor necrosis factor receptor-associated factor 6; n=1; Branchiostoma belcheri|Rep: Tumor necrosis factor receptor-associated factor 6 - Branchiostoma belcheri (Amphioxus) Length = 642 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +Y+C +CL + P + +CGH FC C+ Sbjct: 51 KYECPICLMGLREPVQTNCGHRFCRYCI 78 >UniRef50_A0CJI5 Cluster: Chromosome undetermined scaffold_2, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_2, whole genome shotgun sequence - Paramecium tetraurelia Length = 285 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 +++ +C++C + + P KL C H+FC C+ V Sbjct: 16 SLQENCSICFEDFEDPVKLPCNHIFCRDCIVV 47 >UniRef50_Q7SDX8 Cluster: Putative uncharacterized protein NCU03277.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU03277.1 - Neurospora crassa Length = 429 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL++ + P CGHVFC+ C+ Sbjct: 377 CTLCLEELKDPAATQCGHVFCWSCI 401 >UniRef50_Q4P9E6 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 776 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +Y CA+C P +L C H+FC C+ Sbjct: 676 DYSCAICTSVAWRPVRLDCSHLFCLRCL 703 >UniRef50_Q0Q0M9 Cluster: RING-1; n=2; Gibberella zeae|Rep: RING-1 - Gibberella zeae (Fusarium graminearum) Length = 365 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL++ + P+ CGHVFC+ C+ Sbjct: 313 CTLCLEEMKDPSATQCGHVFCWECI 337 >UniRef50_A6R7U0 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 313 Score = 37.5 bits (83), Expect = 0.058 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +CL+ + P+ +CGH+FC+ C++ Sbjct: 262 CTLCLELYKDPSATTCGHIFCWTCIR 287 >UniRef50_A6QYV1 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 207 Score = 37.5 bits (83), Expect = 0.058 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 Y C VC+ C T CGH+FC C+ Sbjct: 122 YKCPVCMDTCVDATSTICGHLFCHKCI 148 >UniRef50_O00635 Cluster: Tripartite motif-containing protein 38; n=12; Eutheria|Rep: Tripartite motif-containing protein 38 - Homo sapiens (Human) Length = 465 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C++CL +P ++CGH +C LC+ Sbjct: 13 EATCSICLSLMTNPVSINCGHSYCHLCI 40 >UniRef50_P46579 Cluster: Probable tryptophanyl-tRNA synthetase, mitochondrial; n=3; Caenorhabditis|Rep: Probable tryptophanyl-tRNA synthetase, mitochondrial - Caenorhabditis elegans Length = 650 Score = 37.5 bits (83), Expect = 0.058 Identities = 11/28 (39%), Positives = 22/28 (78%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C++CL+ ++P+ L CGH+FC+ C++ Sbjct: 253 FQCSICLEN-KNPSALFCGHLFCWTCIQ 279 >UniRef50_UPI00015561A2 Cluster: PREDICTED: similar to 52 kDa Ro protein (Sjoegren syndrome type A antigen) (SS-A) (Ro(SS-A)) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (Tripartite motif-containing protein 21) (RING finger protein 81); n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to 52 kDa Ro protein (Sjoegren syndrome type A antigen) (SS-A) (Ro(SS-A)) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (Tripartite motif-containing protein 21) (RING finger protein 81) - Ornithorhynchus anatinus Length = 483 Score = 37.1 bits (82), Expect = 0.077 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 181 SHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 S + E C +CL +P L CGH FC C+ Sbjct: 4 SFHEEVTCPICLDYFNYPISLGCGHTFCSHCI 35 >UniRef50_UPI0001554E35 Cluster: PREDICTED: similar to brain finger protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to brain finger protein - Ornithorhynchus anatinus Length = 630 Score = 37.1 bits (82), Expect = 0.077 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +1 Query: 187 NMEYD--CAVCLQKCQHPTKLSCGHVFCFLCV 276 N+E D C++CL + PT L C H FC C+ Sbjct: 12 NLEEDLTCSICLDLLEDPTSLECAHNFCSTCI 43 >UniRef50_UPI0000F1D5F9 Cluster: PREDICTED: similar to MGC131155 protein; n=1; Danio rerio|Rep: PREDICTED: similar to MGC131155 protein - Danio rerio Length = 942 Score = 37.1 bits (82), Expect = 0.077 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 154 VLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +++ L+ + + +CA+CL + P C HVFC C+ Sbjct: 681 LIQKITLVLNSGSDEECAICLDSLRQPVITYCAHVFCRPCI 721 >UniRef50_UPI0000E80EEF Cluster: PREDICTED: hypothetical protein; n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 404 Score = 37.1 bits (82), Expect = 0.077 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++CL ++P L CGH FC CV+ Sbjct: 17 ELTCSICLSLYKNPVSLCCGHSFCKQCVQ 45 >UniRef50_Q5TZ71 Cluster: Novel zinc finger protein; n=3; Clupeocephala|Rep: Novel zinc finger protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 227 Score = 37.1 bits (82), Expect = 0.077 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C VCLQ +P + +CGH+FC C+ Sbjct: 48 CPVCLQMATYPVETNCGHLFCAPCL 72 >UniRef50_Q502G4 Cluster: Wu:fi33g05 protein; n=6; Danio rerio|Rep: Wu:fi33g05 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 470 Score = 37.1 bits (82), Expect = 0.077 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ C VC HP L+CGH FC C++ Sbjct: 13 EFSCPVCRDVFTHPVVLTCGHSFCRGCIE 41 >UniRef50_Q4SZ81 Cluster: Chromosome undetermined SCAF11805, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF11805, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 32 Score = 37.1 bits (82), Expect = 0.077 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ CA+CL +P+ CGH FC C+ Sbjct: 3 QFQCAICLDLFTNPSSTPCGHSFCLRCI 30 >UniRef50_Q00SP9 Cluster: E3 ubiquitin ligase; n=2; Ostreococcus|Rep: E3 ubiquitin ligase - Ostreococcus tauri Length = 412 Score = 37.1 bits (82), Expect = 0.077 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+C +KC KL C H+FC C+ Sbjct: 342 CAICQEKCVDAIKLRCSHIFCDDCI 366 >UniRef50_Q4QI41 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 506 Score = 37.1 bits (82), Expect = 0.077 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 163 HAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 H+V++ + E+ C +C++ P CGHV+C C+ Sbjct: 46 HSVVMRATPEEFQCPICMEMPTAPRITECGHVYCLPCI 83 >UniRef50_Q1RPY5 Cluster: Zinc finger protein; n=1; Ciona intestinalis|Rep: Zinc finger protein - Ciona intestinalis (Transparent sea squirt) Length = 579 Score = 37.1 bits (82), Expect = 0.077 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +Y C +CL + P + CGH FC LC+ Sbjct: 43 KYMCPICLLALRDPVQTECGHRFCHLCI 70 >UniRef50_A7APP9 Cluster: Putative uncharacterized protein; n=1; Babesia bovis|Rep: Putative uncharacterized protein - Babesia bovis Length = 159 Score = 37.1 bits (82), Expect = 0.077 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVKV*NILLFFLNKRN 318 YDC +C + P CGH+FC+ C LL ++NK N Sbjct: 28 YDCNICFEDVVDPVVTRCGHLFCWQC------LLTWINKPN 62 >UniRef50_Q8SU36 Cluster: Similarity to HYPOTHETICAL ZINC FINGER PROTEIN (C3HC4 class) YQ57_CAEEL; n=1; Encephalitozoon cuniculi|Rep: Similarity to HYPOTHETICAL ZINC FINGER PROTEIN (C3HC4 class) YQ57_CAEEL - Encephalitozoon cuniculi Length = 187 Score = 37.1 bits (82), Expect = 0.077 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 EY C++C + + P CGH+FC+ C+ + Sbjct: 52 EYTCSICYSQPEGPVLTPCGHLFCWGCIYI 81 >UniRef50_Q0U7P5 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 499 Score = 37.1 bits (82), Expect = 0.077 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 +Y C +C++ P KL C HVFC C+ V Sbjct: 373 DYSCPMCMEIKWRPVKLRCDHVFCIRCLIV 402 >UniRef50_O70418 Cluster: Zinc finger protein 179; n=12; Eutheria|Rep: Zinc finger protein 179 - Rattus norvegicus (Rat) Length = 631 Score = 37.1 bits (82), Expect = 0.077 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLC 273 C++CL++ + P L CGH FC C Sbjct: 57 CSICLERLREPISLDCGHDFCIRC 80 >UniRef50_O14212 Cluster: Uncharacterized RING finger protein C6B12.07c; n=1; Schizosaccharomyces pombe|Rep: Uncharacterized RING finger protein C6B12.07c - Schizosaccharomyces pombe (Fission yeast) Length = 456 Score = 37.1 bits (82), Expect = 0.077 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +++CA+C P +L C HVFC C+ Sbjct: 357 DFECAICSNVAYKPVRLGCSHVFCLHCL 384 >UniRef50_UPI0000E80EEE Cluster: PREDICTED: similar to LOC432183 protein; n=3; Gallus gallus|Rep: PREDICTED: similar to LOC432183 protein - Gallus gallus Length = 545 Score = 36.7 bits (81), Expect = 0.10 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C+VCL ++P L CGH FC C++ Sbjct: 13 ELTCSVCLDIYRNPVSLGCGHSFCEECIQ 41 >UniRef50_UPI0000D9E507 Cluster: PREDICTED: similar to tripartite motif-containing 65; n=1; Macaca mulatta|Rep: PREDICTED: similar to tripartite motif-containing 65 - Macaca mulatta Length = 489 Score = 36.7 bits (81), Expect = 0.10 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 CA+CL Q P L CGH FC C++ Sbjct: 12 CAICLGLYQDPVTLPCGHNFCGACIR 37 >UniRef50_UPI00006604C6 Cluster: Homolog of Homo sapiens "Splice Isoform 1 of Tripartite motif protein 16; n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens "Splice Isoform 1 of Tripartite motif protein 16 - Takifugu rubripes Length = 473 Score = 36.7 bits (81), Expect = 0.10 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C+VCL + P L CGH +C C++ Sbjct: 3 FACSVCLDTLKEPATLPCGHSYCLACIQ 30 >UniRef50_A5PLE6 Cluster: Zgc:165577 protein; n=2; Danio rerio|Rep: Zgc:165577 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 445 Score = 36.7 bits (81), Expect = 0.10 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 172 LIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 L SH E C++CL +P + CGH +C C++ Sbjct: 6 LTVSHE-ELSCSICLDLLNNPVTIPCGHNYCMNCIR 40 >UniRef50_Q9SZS2 Cluster: Putative RING zinc finger protein; n=2; Arabidopsis thaliana|Rep: Putative RING zinc finger protein - Arabidopsis thaliana (Mouse-ear cress) Length = 264 Score = 36.7 bits (81), Expect = 0.10 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +DC +CL P CGH+FC+ C+ Sbjct: 54 FDCNICLDTAHDPVVTLCGHLFCWPCI 80 >UniRef50_Q8H0X2 Cluster: Expressed protein; n=4; core eudicotyledons|Rep: Expressed protein - Arabidopsis thaliana (Mouse-ear cress) Length = 486 Score = 36.7 bits (81), Expect = 0.10 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++DC VCL+ P CGH FC C+ Sbjct: 193 DFDCTVCLKLLYEPATTPCGHTFCRSCL 220 >UniRef50_Q84SC7 Cluster: Zinc finger (C3HC4-type RING finger) protein-like; n=2; Oryza sativa|Rep: Zinc finger (C3HC4-type RING finger) protein-like - Oryza sativa subsp. japonica (Rice) Length = 455 Score = 36.7 bits (81), Expect = 0.10 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 N ++C +C + + P CGH+FC+ C+ Sbjct: 236 NGSFECNICFESAKDPVVTPCGHLFCWPCI 265 >UniRef50_Q67UM6 Cluster: Putative ring finger protein 10; n=3; Oryza sativa|Rep: Putative ring finger protein 10 - Oryza sativa subsp. japonica (Rice) Length = 744 Score = 36.7 bits (81), Expect = 0.10 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P SCGH++CF C+ Sbjct: 238 EVQCPICLESPLCPQITSCGHIYCFPCI 265 >UniRef50_Q27U16 Cluster: Tripartite motif protein 5 alpha; n=5; Laurasiatheria|Rep: Tripartite motif protein 5 alpha - Bos taurus (Bovine) Length = 511 Score = 36.7 bits (81), Expect = 0.10 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P L CGH FC C+ Sbjct: 12 EVTCPICLELLTEPLSLDCGHTFCQACI 39 >UniRef50_A0BPP8 Cluster: Chromosome undetermined scaffold_12, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_12, whole genome shotgun sequence - Paramecium tetraurelia Length = 258 Score = 36.7 bits (81), Expect = 0.10 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E+ C++C Q P K +CGH FC C+ Sbjct: 14 EFICSICFQIFTKPIKTTCGHNFCIKCI 41 >UniRef50_Q6FJ71 Cluster: Candida glabrata strain CBS138 chromosome M complete sequence; n=1; Candida glabrata|Rep: Candida glabrata strain CBS138 chromosome M complete sequence - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 328 Score = 36.7 bits (81), Expect = 0.10 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 172 LIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 L F +C +CL + P+ L CGHVFC+ C+ Sbjct: 267 LAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCI 301 >UniRef50_Q2HD59 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 370 Score = 36.7 bits (81), Expect = 0.10 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLC 273 C +CL++ + P CGHVFC+ C Sbjct: 342 CTLCLEELKDPAATQCGHVFCWAC 365 >UniRef50_Q0UIT5 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 612 Score = 36.7 bits (81), Expect = 0.10 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E DC VC PT SCGH FC C+ Sbjct: 286 ELDCLVCYNLMLDPTTTSCGHTFCRRCL 313 >UniRef50_Q9ULX5 Cluster: Zinc finger protein 179; n=9; Eutheria|Rep: Zinc finger protein 179 - Homo sapiens (Human) Length = 632 Score = 36.7 bits (81), Expect = 0.10 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLC 273 C++CL++ + P L CGH FC C Sbjct: 57 CSICLERLRDPISLDCGHDFCIRC 80 >UniRef50_Q6PJ69 Cluster: Tripartite motif-containing protein 65; n=16; Eutheria|Rep: Tripartite motif-containing protein 65 - Homo sapiens (Human) Length = 517 Score = 36.7 bits (81), Expect = 0.10 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 CA+CL Q P L CGH FC C++ Sbjct: 12 CAICLGLYQDPVTLPCGHNFCGACIR 37 >UniRef50_Q5EBN2 Cluster: Putative tripartite motif-containing protein 61; n=1; Homo sapiens|Rep: Putative tripartite motif-containing protein 61 - Homo sapiens (Human) Length = 209 Score = 36.7 bits (81), Expect = 0.10 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL + P +SCGH FC C+ Sbjct: 13 EASCPICLDYLKDPVTISCGHNFCLSCI 40 >UniRef50_Q96LD4 Cluster: Tripartite motif-containing protein 47; n=20; Eutheria|Rep: Tripartite motif-containing protein 47 - Homo sapiens (Human) Length = 638 Score = 36.7 bits (81), Expect = 0.10 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + C +CL+ + P L CGH FC C+ Sbjct: 7 FSCPICLEPLREPVTLPCGHNFCLACL 33 >UniRef50_Q14527 Cluster: Helicase-like transcription factor; n=33; Euteleostomi|Rep: Helicase-like transcription factor - Homo sapiens (Human) Length = 1009 Score = 36.7 bits (81), Expect = 0.10 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 154 VLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +++ LI S + +CA+CL P C HVFC C+ Sbjct: 744 LIRKMKLILSSGSDEECAICLDSLTVPVITHCAHVFCKPCI 784 >UniRef50_UPI0001554FFF Cluster: PREDICTED: similar to zinc finger protein 179; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to zinc finger protein 179 - Ornithorhynchus anatinus Length = 611 Score = 36.3 bits (80), Expect = 0.13 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 ++ C++CL + P L CGH FC C+ V Sbjct: 7 DFTCSICLDLLKSPITLECGHNFCSDCITV 36 >UniRef50_UPI0000F2D687 Cluster: PREDICTED: hypothetical protein; n=2; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 465 Score = 36.3 bits (80), Expect = 0.13 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C VCL P L CGH FC LC+ Sbjct: 13 ELTCPVCLDYFSRPVTLGCGHNFCRLCL 40 >UniRef50_UPI0000F1D951 Cluster: PREDICTED: similar to novel zinc finger protein; n=7; Danio rerio|Rep: PREDICTED: similar to novel zinc finger protein - Danio rerio Length = 496 Score = 36.3 bits (80), Expect = 0.13 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 E C VC + + P LSCGH FC C+++ Sbjct: 8 ELSCPVCTESFRSPVMLSCGHSFCKECLQL 37 >UniRef50_UPI0000F1D818 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 568 Score = 36.3 bits (80), Expect = 0.13 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++ C+VCL+ P + CGH +C C+K Sbjct: 12 QFCCSVCLEVLWEPVTIPCGHSYCMECIK 40 >UniRef50_Q503I6 Cluster: Zgc:110566; n=14; Danio rerio|Rep: Zgc:110566 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 440 Score = 36.3 bits (80), Expect = 0.13 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ C VCL Q P ++CGH +C C+ Sbjct: 12 QFMCPVCLNLLQDPVTIACGHSYCMSCI 39 >UniRef50_Q4RGU8 Cluster: Chromosome undetermined SCAF15092, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF15092, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 451 Score = 36.3 bits (80), Expect = 0.13 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C VCL+ P L CGH FC CV+ Sbjct: 15 CDVCLEVFSEPVSLPCGHTFCRACVE 40 >UniRef50_A4FUN6 Cluster: Zgc:136797 protein; n=52; Coelomata|Rep: Zgc:136797 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 438 Score = 36.3 bits (80), Expect = 0.13 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +++C++CL + P + CGH +C C+ Sbjct: 12 QFNCSICLDLLKDPVAIPCGHSYCMCCI 39 >UniRef50_Q8R0K2 Cluster: Tripartite motif-containing 31; n=7; Murinae|Rep: Tripartite motif-containing 31 - Mus musculus (Mouse) Length = 507 Score = 36.3 bits (80), Expect = 0.13 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +C++ Q P + CGH FC C+ Sbjct: 13 EVTCPICMEILQDPVTIDCGHNFCLQCI 40 >UniRef50_Q0DHF0 Cluster: Os05g0470700 protein; n=6; Oryza sativa|Rep: Os05g0470700 protein - Oryza sativa subsp. japonica (Rice) Length = 562 Score = 36.3 bits (80), Expect = 0.13 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +C + P SCGH+FC+ C+ Sbjct: 236 FECNICFEMASEPVVTSCGHLFCWPCL 262 >UniRef50_A7PVX9 Cluster: Chromosome chr8 scaffold_34, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr8 scaffold_34, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 410 Score = 36.3 bits (80), Expect = 0.13 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +DC +CL + P CGH+FC+ C+ Sbjct: 132 FDCNICLDLARDPVVTCCGHLFCWPCL 158 >UniRef50_A4S5F4 Cluster: Predicted protein; n=2; Ostreococcus|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 173 Score = 36.3 bits (80), Expect = 0.13 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 CAVCL + T CGHVFC CV+ Sbjct: 122 CAVCLDDYVNATTTRCGHVFCARCVR 147 >UniRef50_Q9UAC4 Cluster: TRAF6; n=4; Sophophora|Rep: TRAF6 - Drosophila melanogaster (Fruit fly) Length = 475 Score = 36.3 bits (80), Expect = 0.13 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 Y+CA+C+ P SCGH FC C+ Sbjct: 102 YECAICIDWLNEPVLTSCGHRFCRSCL 128 >UniRef50_Q95ZB8 Cluster: RING finger protein; n=6; Trypanosomatidae|Rep: RING finger protein - Leishmania major Length = 296 Score = 36.3 bits (80), Expect = 0.13 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL + PT +CGH+FC+ C+ Sbjct: 221 CMLCLSNRKCPTATNCGHIFCWRCI 245 >UniRef50_Q7Q6I3 Cluster: ENSANGP00000017420; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000017420 - Anopheles gambiae str. PEST Length = 310 Score = 36.3 bits (80), Expect = 0.13 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 202 CAVCLQKCQHPT-KLSCGHVFCFLCV 276 CA+CL KC+ P SC H FCF C+ Sbjct: 28 CAICLGKCRQPAFANSCKHQFCFRCL 53 >UniRef50_Q6LF01 Cluster: Putative c3h4-type ring finger protein; n=1; Plasmodium falciparum 3D7|Rep: Putative c3h4-type ring finger protein - Plasmodium falciparum (isolate 3D7) Length = 449 Score = 36.3 bits (80), Expect = 0.13 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +C + P CGH+FC+LC+ Sbjct: 288 FECNICFDDVRDPVVTKCGHLFCWLCL 314 >UniRef50_Q4Q883 Cluster: DNA repair protein-like protein; n=3; Leishmania|Rep: DNA repair protein-like protein - Leishmania major Length = 922 Score = 36.3 bits (80), Expect = 0.13 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +C +CL+ P L C HVFC C+K Sbjct: 618 ECIICLETVNRPAILPCAHVFCEECIK 644 >UniRef50_Q38AW8 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 219 Score = 36.3 bits (80), Expect = 0.13 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ CA+C + P CGH+FC+ C+ Sbjct: 5 DFSCAICYEVASEPVVTRCGHLFCWRCL 32 >UniRef50_Q293B6 Cluster: GA14295-PA; n=1; Drosophila pseudoobscura|Rep: GA14295-PA - Drosophila pseudoobscura (Fruit fly) Length = 85 Score = 36.3 bits (80), Expect = 0.13 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 CA CL++ ++P KL C H FC C++ Sbjct: 3 CAFCLEQIRNPVKLRCSHTFCKGCLQ 28 >UniRef50_A5K2A5 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 519 Score = 36.3 bits (80), Expect = 0.13 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +C + P CGH+FC+LC+ Sbjct: 362 FECNICFDDVRDPVVTKCGHLFCWLCL 388 >UniRef50_A2EBM4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 180 Score = 36.3 bits (80), Expect = 0.13 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C++C+++ P CGHVFC C++ Sbjct: 79 CSICMEELHDPVSTPCGHVFCRRCIE 104 >UniRef50_A1A749 Cluster: IP17576p; n=2; Drosophila melanogaster|Rep: IP17576p - Drosophila melanogaster (Fruit fly) Length = 108 Score = 36.3 bits (80), Expect = 0.13 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 N Y C VC+Q + P CGH FC C+ Sbjct: 29 NSYYTCLVCMQTAESPRVSFCGHHFCSQCI 58 >UniRef50_Q6FXK7 Cluster: Similarities with tr|Q06554 Saccharomyces cerevisiae YLR247c; n=1; Candida glabrata|Rep: Similarities with tr|Q06554 Saccharomyces cerevisiae YLR247c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1470 Score = 36.3 bits (80), Expect = 0.13 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 N +C++CLQ + ++CGH+FC C+ Sbjct: 1159 NTTMECSICLQPITNGAMVNCGHLFCTSCI 1188 >UniRef50_Q6CGG7 Cluster: Similar to tr|Q06436 Saccharomyces cerevisiae YLR427w; n=1; Yarrowia lipolytica|Rep: Similar to tr|Q06436 Saccharomyces cerevisiae YLR427w - Yarrowia lipolytica (Candida lipolytica) Length = 585 Score = 36.3 bits (80), Expect = 0.13 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 DC +CL + P L CGH+ C C+K Sbjct: 166 DCLICLCEPTAPRMLGCGHIMCLACLK 192 >UniRef50_A4RG64 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 260 Score = 36.3 bits (80), Expect = 0.13 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL+ + P+ CGHVFC+ C+ Sbjct: 205 CTLCLEGLRDPSATPCGHVFCWSCI 229 >UniRef50_A2QI07 Cluster: Contig An04c0100, complete genome; n=2; Aspergillus|Rep: Contig An04c0100, complete genome - Aspergillus niger Length = 473 Score = 36.3 bits (80), Expect = 0.13 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C VC++ P L+CGH FC+ C+ Sbjct: 49 CGVCIRPLYEPYTLACGHTFCYSCL 73 >UniRef50_Q8NG06 Cluster: Tripartite motif-containing protein 58; n=12; Theria|Rep: Tripartite motif-containing protein 58 - Homo sapiens (Human) Length = 486 Score = 36.3 bits (80), Expect = 0.13 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C VCL Q P + CGH FC C+ Sbjct: 16 CPVCLDFLQEPVSVDCGHSFCLRCI 40 >UniRef50_Q9HCM9 Cluster: Tripartite motif-containing protein 39; n=40; Amniota|Rep: Tripartite motif-containing protein 39 - Homo sapiens (Human) Length = 518 Score = 36.3 bits (80), Expect = 0.13 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +E C+VCL+ + P + CGH FC C+ Sbjct: 25 VEASCSVCLEYLKEPVIIECGHNFCKACI 53 >UniRef50_Q12899 Cluster: Tripartite motif-containing protein 26; n=37; Theria|Rep: Tripartite motif-containing protein 26 - Homo sapiens (Human) Length = 539 Score = 36.3 bits (80), Expect = 0.13 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLC 273 E C++CL + P + CGHVFC C Sbjct: 13 EVTCSICLDYLRDPVTIDCGHVFCRSC 39 >UniRef50_UPI0000F2D1E9 Cluster: PREDICTED: hypothetical protein; n=2; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 504 Score = 35.9 bits (79), Expect = 0.18 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 172 LIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 L+ S E C++CL P L+CGH FC C+ Sbjct: 6 LVRSLQQETTCSICLTFFTKPVTLNCGHSFCQFCL 40 >UniRef50_UPI0000F1F953 Cluster: PREDICTED: hypothetical protein; n=4; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 506 Score = 35.9 bits (79), Expect = 0.18 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ C+VCL + P ++CGH +C C+ Sbjct: 12 QFSCSVCLDLLKDPVTINCGHSYCMSCL 39 >UniRef50_UPI0000E47F4C Cluster: PREDICTED: similar to Kelch motif family protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Kelch motif family protein - Strongylocentrotus purpuratus Length = 332 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL + PT L+CGH FC +C+ Sbjct: 15 CPLCLDAFKAPTLLACGHTFCKVCL 39 >UniRef50_UPI0000E47DF0 Cluster: PREDICTED: similar to ligand of numb-protein X 3, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ligand of numb-protein X 3, partial - Strongylocentrotus purpuratus Length = 99 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C +CLQ +P CGH FC C++ Sbjct: 42 ELTCNICLQPLVNPMDTMCGHTFCMRCLR 70 >UniRef50_UPI00015A4985 Cluster: zgc:162037 (zgc:162037), mRNA; n=6; Danio rerio|Rep: zgc:162037 (zgc:162037), mRNA - Danio rerio Length = 538 Score = 35.9 bits (79), Expect = 0.18 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL + P +SCGH FC C+ Sbjct: 3 CPICLDLLKDPVTISCGHSFCMSCI 27 >UniRef50_UPI000069F651 Cluster: UPI000069F651 related cluster; n=12; Xenopus tropicalis|Rep: UPI000069F651 UniRef100 entry - Xenopus tropicalis Length = 536 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E +C++CL P L CGH FC C++ Sbjct: 19 ELNCSICLDIYTDPVMLPCGHNFCLSCIQ 47 >UniRef50_Q96K19-2 Cluster: Isoform 2 of Q96K19 ; n=4; Eutheria|Rep: Isoform 2 of Q96K19 - Homo sapiens (Human) Length = 236 Score = 35.9 bits (79), Expect = 0.18 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL + P + +CGH+FC C+ Sbjct: 87 CPICLHQASFPVETNCGHLFCGACI 111 >UniRef50_Q800L5 Cluster: Probable RING-B-box-coiled coil protein; n=1; Anguilla japonica|Rep: Probable RING-B-box-coiled coil protein - Anguilla japonica (Japanese eel) Length = 514 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 175 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 IF + C++CL P +CGH FC C+ Sbjct: 6 IFLSTEQLQCSICLDNLHQPGVHACGHSFCMTCI 39 >UniRef50_Q4SQS3 Cluster: Chromosome undetermined SCAF14531, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF14531, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 333 Score = 35.9 bits (79), Expect = 0.18 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C++C+ Q+P L CGH FC C+ Sbjct: 20 CSICMDLFQNPVTLGCGHTFCRQCL 44 >UniRef50_Q4S3M0 Cluster: Chromosome 1 SCAF14749, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 1 SCAF14749, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 530 Score = 35.9 bits (79), Expect = 0.18 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C VCL+ + P L CGH FC +C+ Sbjct: 13 ELTCPVCLELFRDPVILDCGHHFCKVCI 40 >UniRef50_Q3UWZ0 Cluster: In vitro fertilized eggs cDNA, RIKEN full-length enriched library, clone:7420447M23 product:hypothetical Butyrophylin-like/Zn-finger, B- box/SPla/RYanodine receptor SPRY/Zn-finger, RING containing protein, full insert sequence; n=3; Mus musculus|Rep: In vitro fertilized eggs cDNA, RIKEN full-length enriched library, clone:7420447M23 product:hypothetical Butyrophylin-like/Zn-finger, B- box/SPla/RYanodine receptor SPRY/Zn-finger, RING containing protein, full insert sequence - Mus musculus (Mouse) Length = 467 Score = 35.9 bits (79), Expect = 0.18 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 157 LKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + H ++ E C +CL P + CGH FC C+K Sbjct: 1 MAHVEVLARLQKETKCPICLDDLTDPVTVECGHNFCRSCIK 41 >UniRef50_A7QZ00 Cluster: Chromosome undetermined scaffold_260, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome undetermined scaffold_260, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 174 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLC 273 +EY+C VC+ + + + CGH FC LC Sbjct: 122 IEYNCCVCMVRHKGAAFIPCGHTFCRLC 149 >UniRef50_A7QRA0 Cluster: Chromosome chr13 scaffold_149, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr13 scaffold_149, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 404 Score = 35.9 bits (79), Expect = 0.18 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLC 273 +DC +CL + P CGH+FC+ C Sbjct: 112 FDCNICLDMARDPILTCCGHLFCWPC 137 >UniRef50_Q68KK3 Cluster: TRIM5/cyclophilin A V3 fusion protein; n=2; Aotus trivirgatus|Rep: TRIM5/cyclophilin A V3 fusion protein - Aotus trivirgatus (Night monkey) (Douroucouli) Length = 462 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P L CGH FC C+ Sbjct: 12 EVTCPICLELLTEPLSLDCGHSFCQACI 39 >UniRef50_Q7JNM2 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 398 Score = 35.9 bits (79), Expect = 0.18 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E CAVC P KL C HVFC C++ Sbjct: 334 EQPCAVCHGDLLQPIKLECTHVFCKFCIE 362 >UniRef50_Q61UN6 Cluster: Putative uncharacterized protein CBG05218; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG05218 - Caenorhabditis briggsae Length = 260 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 CA+CL P ++ CGH+ CF C K Sbjct: 37 CAICLHAVYMPFRMPCGHINCFNCQK 62 >UniRef50_Q55CM6 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 825 Score = 35.9 bits (79), Expect = 0.18 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +1 Query: 157 LKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ + + + + C +CL+K P CGH+ C+ C+ Sbjct: 269 VEQVIYLINESHSIQCPICLEKPIAPKITKCGHILCYTCI 308 >UniRef50_Q54S31 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 380 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ H T CGH+FC+ C+ Sbjct: 319 EQKCTLCLEVRTHTTATICGHLFCWHCI 346 >UniRef50_A2FB19 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 202 Score = 35.9 bits (79), Expect = 0.18 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C +C+++ P CGHVFC C++ Sbjct: 101 FTCPICMEELHDPVATPCGHVFCRRCIE 128 >UniRef50_A0ED31 Cluster: Chromosome undetermined scaffold_9, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_9, whole genome shotgun sequence - Paramecium tetraurelia Length = 245 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 Y C +CL P KL C H+FC C+ Sbjct: 7 YTCPICLGVFVDPCKLQCNHIFCLSCL 33 >UniRef50_A0CL65 Cluster: Chromosome undetermined scaffold_20, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_20, whole genome shotgun sequence - Paramecium tetraurelia Length = 295 Score = 35.9 bits (79), Expect = 0.18 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E++C++CL +P + CGH FC C+ Sbjct: 14 EFECSLCLTFLTNPITIPCGHTFCKECI 41 >UniRef50_A0C7Z2 Cluster: Chromosome undetermined scaffold_156, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_156, whole genome shotgun sequence - Paramecium tetraurelia Length = 175 Score = 35.9 bits (79), Expect = 0.18 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +CL+ P +CGH+FC+ C+ Sbjct: 17 FECNICLEIATEPILTNCGHLFCWPCI 43 >UniRef50_Q000Q6 Cluster: RING-14 protein; n=1; Gibberella zeae|Rep: RING-14 protein - Gibberella zeae (Fusarium graminearum) Length = 511 Score = 35.9 bits (79), Expect = 0.18 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +Y C VC P +L C HVFC CV Sbjct: 413 DYLCPVCFSVAYMPVRLDCQHVFCIRCV 440 >UniRef50_A3LNG3 Cluster: Predicted protein; n=4; Saccharomycetales|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 130 Score = 35.9 bits (79), Expect = 0.18 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C +C + T SCGH+FC C++ Sbjct: 51 EVQCPICFDEVTMATSTSCGHIFCLECIQ 79 >UniRef50_Q11096 Cluster: Uncharacterized RING finger protein C02B8.6; n=1; Caenorhabditis elegans|Rep: Uncharacterized RING finger protein C02B8.6 - Caenorhabditis elegans Length = 347 Score = 35.9 bits (79), Expect = 0.18 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +C P +L C H FC++C+K Sbjct: 5 CTICHNTPNRPVRLDCNHEFCYICIK 30 >UniRef50_Q9C029 Cluster: Tripartite motif-containing protein 7; n=33; Mammalia|Rep: Tripartite motif-containing protein 7 - Homo sapiens (Human) Length = 511 Score = 35.9 bits (79), Expect = 0.18 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C++CL+ + P + CGH FC C+ Sbjct: 26 EATCSICLELFREPVSVECGHSFCRACI 53 >UniRef50_Q8BGE7 Cluster: Tripartite motif-containing protein 6; n=21; Eutheria|Rep: Tripartite motif-containing protein 6 - Mus musculus (Mouse) Length = 488 Score = 35.9 bits (79), Expect = 0.18 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P + CGH FC +C+ Sbjct: 12 EVTCPICLELLTEPLSIDCGHSFCQVCI 39 >UniRef50_Q495X7 Cluster: Tripartite motif-containing protein 60; n=7; Eutheria|Rep: Tripartite motif-containing protein 60 - Homo sapiens (Human) Length = 471 Score = 35.9 bits (79), Expect = 0.18 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 E C +CL+ + P ++CGH FC C+ V Sbjct: 13 ESSCPICLEYLKDPVTINCGHNFCRSCLSV 42 >UniRef50_Q96K19 Cluster: RING finger protein 170; n=27; Euteleostomi|Rep: RING finger protein 170 - Homo sapiens (Human) Length = 258 Score = 35.9 bits (79), Expect = 0.18 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL + P + +CGH+FC C+ Sbjct: 87 CPICLHQASFPVETNCGHLFCGACI 111 >UniRef50_UPI000155BACB Cluster: PREDICTED: similar to ZNF173; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to ZNF173 - Ornithorhynchus anatinus Length = 366 Score = 35.5 bits (78), Expect = 0.24 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 E C +CL + P + CGH+FC CV V Sbjct: 12 EVMCPICLSYLRDPIFIDCGHIFCRGCVNV 41 >UniRef50_UPI0000EBE1A7 Cluster: PREDICTED: similar to tripartite motif protein 31 isoform beta; n=2; Bos taurus|Rep: PREDICTED: similar to tripartite motif protein 31 isoform beta - Bos taurus Length = 574 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL Q P + CGH FC C+ Sbjct: 13 EMICPICLDILQDPATIDCGHNFCLSCI 40 >UniRef50_UPI0000E4A30D Cluster: PREDICTED: similar to ring finger protein 127; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ring finger protein 127 - Strongylocentrotus purpuratus Length = 762 Score = 35.5 bits (78), Expect = 0.24 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++ C VC PT L CGH FC CV+ Sbjct: 96 KFSCCVCRGLLSKPTTLLCGHTFCKSCVE 124 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +++C++CL+ PT CGH FC C+ Sbjct: 461 DFECSLCLRLFYQPTTTPCGHTFCRGCL 488 >UniRef50_UPI0000499D42 Cluster: hypothetical protein 113.t00010; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 113.t00010 - Entamoeba histolytica HM-1:IMSS Length = 141 Score = 35.5 bits (78), Expect = 0.24 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C +C + + P CGH FC+ C+K Sbjct: 3 ELQCLICYNEPKQPIITQCGHTFCWKCIK 31 >UniRef50_UPI00015A7B11 Cluster: UPI00015A7B11 related cluster; n=1; Danio rerio|Rep: UPI00015A7B11 UniRef100 entry - Danio rerio Length = 510 Score = 35.5 bits (78), Expect = 0.24 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C +CL+ P SCGH FC +C++ Sbjct: 1 FQCHICLEVFTDPVTTSCGHNFCNICIE 28 >UniRef50_UPI00006601F1 Cluster: Homolog of Homo sapiens "Tripartite motif protein 25; n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens "Tripartite motif protein 25 - Takifugu rubripes Length = 360 Score = 35.5 bits (78), Expect = 0.24 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C VCL+ ++P LSCGH FC C+ Sbjct: 8 CPVCLEVYRNPQLLSCGHNFCKTCL 32 >UniRef50_UPI000065EA16 Cluster: Homolog of Homo sapiens "Ring finger protein 127; n=3; Clupeocephala|Rep: Homolog of Homo sapiens "Ring finger protein 127 - Takifugu rubripes Length = 113 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCV 276 +C +CL P +SCGH FC CV Sbjct: 5 ECPICLFLMSEPVTMSCGHTFCRRCV 30 >UniRef50_Q8AW62 Cluster: Novel protein with RING finger domain; n=2; Danio rerio|Rep: Novel protein with RING finger domain - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 278 Score = 35.5 bits (78), Expect = 0.24 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C +CL + P + CGH +C C+K Sbjct: 12 FTCPICLDALKDPVTIPCGHNYCMSCIK 39 >UniRef50_Q5U3F5 Cluster: Zgc:103602; n=17; Danio rerio|Rep: Zgc:103602 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 550 Score = 35.5 bits (78), Expect = 0.24 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ C VCL + P + CGH +C C+ Sbjct: 12 QFSCPVCLDLLKEPVTIPCGHSYCMSCI 39 >UniRef50_A5HUJ9 Cluster: Tripartite motif protein 7; n=2; Gallus gallus|Rep: Tripartite motif protein 7 - Gallus gallus (Chicken) Length = 588 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C+VCL+ + P + CGH FC C+ Sbjct: 136 EATCSVCLEFFKDPVSIECGHNFCRACI 163 >UniRef50_Q9LUS4 Cluster: Similarity to transcription factors; n=2; Arabidopsis thaliana|Rep: Similarity to transcription factors - Arabidopsis thaliana (Mouse-ear cress) Length = 653 Score = 35.5 bits (78), Expect = 0.24 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVKV 282 C+VC + P CGHVFC+ CV V Sbjct: 395 CSVCSDPPKDPVVTLCGHVFCYECVSV 421 >UniRef50_Q9LSE3 Cluster: Emb|CAA66822.1; n=4; core eudicotyledons|Rep: Emb|CAA66822.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 772 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL+ P SCGH+FCF C+ Sbjct: 245 CPICLEYPLCPQITSCGHIFCFPCI 269 >UniRef50_Q9LN67 Cluster: F18O14.3; n=13; Magnoliophyta|Rep: F18O14.3 - Arabidopsis thaliana (Mouse-ear cress) Length = 226 Score = 35.5 bits (78), Expect = 0.24 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +CL Q P CGH+FC+ C+ Sbjct: 21 FECNICLDLAQDPIVTLCGHLFCWPCL 47 >UniRef50_Q8IQM1 Cluster: CG32847-PB; n=2; Drosophila melanogaster|Rep: CG32847-PB - Drosophila melanogaster (Fruit fly) Length = 164 Score = 35.5 bits (78), Expect = 0.24 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 Y+C +CL Q+ CGH+FC+ C+ Sbjct: 16 YECNICLDTAQNAVVSMCGHLFCWPCL 42 >UniRef50_Q5CN55 Cluster: Zinc finger protein; n=3; Cryptosporidium|Rep: Zinc finger protein - Cryptosporidium hominis Length = 873 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E+ C VCL P + CGH FC C+ Sbjct: 77 EFTCPVCLDYYMLPVTIPCGHTFCRYCI 104 >UniRef50_Q22RW8 Cluster: Zinc finger, C3HC4 type; n=1; Tetrahymena thermophila SB210|Rep: Zinc finger, C3HC4 type - Tetrahymena thermophila SB210 Length = 224 Score = 35.5 bits (78), Expect = 0.24 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 N +DC +C P L CGH FC C+K Sbjct: 16 NKYFDCFICKDILLKPVTLICGHSFCSHCIK 46 >UniRef50_Q18199 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 306 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 202 CAVCLQKCQHPTKL-SCGHVFCFLCVK 279 C +C K PT++ +CGH FC++C+K Sbjct: 107 CYICYYKLTIPTRIENCGHEFCYVCLK 133 >UniRef50_A0CG76 Cluster: Chromosome undetermined scaffold_179, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_179, whole genome shotgun sequence - Paramecium tetraurelia Length = 239 Score = 35.5 bits (78), Expect = 0.24 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLS-CGHVFCFLCV 276 YDC +CL P +LS C H+FC C+ Sbjct: 5 YDCPICLSISVDPIQLSQCNHIFCSACI 32 >UniRef50_Q7SAR3 Cluster: Putative uncharacterized protein NCU07975.1; n=3; Sordariomycetes|Rep: Putative uncharacterized protein NCU07975.1 - Neurospora crassa Length = 950 Score = 35.5 bits (78), Expect = 0.24 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +1 Query: 142 DNLCVLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +N +L+ A+ ++ + E +C +C+ +P C HVFC C+ Sbjct: 690 ENRAILQQALQLYIESQE-ECPICIDPLSNPIITHCKHVFCRGCI 733 >UniRef50_Q55NY4 Cluster: Putative uncharacterized protein; n=2; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 666 Score = 35.5 bits (78), Expect = 0.24 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +Y C +C P +L+CGH+FC C+ Sbjct: 568 DYACLICTSIAFKPIRLACGHLFCVRCL 595 >UniRef50_Q1DR10 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 957 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 +Y C +CL P +L C HVFC C+ + Sbjct: 329 DYLCPICLSISFKPVRLRCNHVFCIRCLVI 358 >UniRef50_Q8WV44 Cluster: Tripartite motif-containing protein 41; n=27; Mammalia|Rep: Tripartite motif-containing protein 41 - Homo sapiens (Human) Length = 630 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+CL P + CGH FC +CV Sbjct: 20 CAICLDYFTDPVSIGCGHNFCRVCV 44 >UniRef50_Q9BZY9 Cluster: Tripartite motif-containing protein 31; n=12; Homo/Pan/Gorilla group|Rep: Tripartite motif-containing protein 31 - Homo sapiens (Human) Length = 425 Score = 35.5 bits (78), Expect = 0.24 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL Q P + CGH FC C+ Sbjct: 13 EVICPICLDILQKPVTIDCGHNFCLKCI 40 >UniRef50_Q92265 Cluster: Peroxisome assembly protein 10; n=2; Saccharomycetaceae|Rep: Peroxisome assembly protein 10 - Pichia pastoris (Yeast) Length = 419 Score = 35.5 bits (78), Expect = 0.24 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL +PT +CGH FC+ C+ Sbjct: 298 CMLCLSYMTNPTAANCGHCFCWSCI 322 >UniRef50_Q1L5Z9 Cluster: LON peptidase N-terminal domain and RING finger protein 2; n=12; Eutheria|Rep: LON peptidase N-terminal domain and RING finger protein 2 - Homo sapiens (Human) Length = 754 Score = 35.5 bits (78), Expect = 0.24 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +++CA+C++ P CGH FC C++ Sbjct: 446 DFECALCMRLLFEPVTTPCGHTFCLKCLE 474 >UniRef50_Q8N448 Cluster: Ligand of Numb protein X 2; n=26; Euteleostomi|Rep: Ligand of Numb protein X 2 - Homo sapiens (Human) Length = 690 Score = 35.5 bits (78), Expect = 0.24 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +CLQ P CGH FC+ C++ Sbjct: 50 CHICLQPLLQPLDTPCGHTFCYKCLR 75 >UniRef50_UPI0001554C5C Cluster: PREDICTED: similar to tripartite motif-containing 39; n=4; Mammalia|Rep: PREDICTED: similar to tripartite motif-containing 39 - Ornithorhynchus anatinus Length = 527 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 181 SHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 S +E C++CL P + CGH FC C+ Sbjct: 67 SLQVEASCSICLDYLNDPVTIDCGHNFCRSCI 98 >UniRef50_UPI0000F2B28A Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 390 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 157 LKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + + LI S + + C++CL P + CGH FC C+ Sbjct: 1 MDYKALIESFSADLTCSICLDYFSDPVIIKCGHNFCRKCL 40 >UniRef50_UPI0000F2B1A9 Cluster: PREDICTED: similar to tripartite motif-containing 4,; n=9; Monodelphis domestica|Rep: PREDICTED: similar to tripartite motif-containing 4, - Monodelphis domestica Length = 104 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C++CL P L CGH FC CV Sbjct: 21 ELTCSICLDLFTQPVTLDCGHSFCRECV 48 >UniRef50_UPI0000F21ADE Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 672 Score = 35.1 bits (77), Expect = 0.31 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ C VCL + P + CGH +C C+ Sbjct: 12 QFSCPVCLDLLKDPVTIPCGHSYCMRCI 39 >UniRef50_UPI0000E4915D Cluster: PREDICTED: similar to TRAF6; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to TRAF6 - Strongylocentrotus purpuratus Length = 529 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +Y C VCL + P + CGH FC +C+ Sbjct: 109 KYVCPVCLSALRDPLQTKCGHRFCKVCL 136 >UniRef50_UPI0000E4784B Cluster: PREDICTED: similar to RFWD3 protein, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to RFWD3 protein, partial - Strongylocentrotus purpuratus Length = 1329 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +CL+ + PT L CGH FC C++ Sbjct: 741 CPLCLEAFKSPTLLQCGHTFCKDCLQ 766 >UniRef50_UPI00015A7073 Cluster: Zgc:85925.; n=1; Danio rerio|Rep: Zgc:85925. - Danio rerio Length = 746 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CLQ P CGH +CF C+ Sbjct: 35 ELVCHICLQPLLQPMDTPCGHTYCFQCL 62 >UniRef50_UPI00015A6924 Cluster: UPI00015A6924 related cluster; n=4; Danio rerio|Rep: UPI00015A6924 UniRef100 entry - Danio rerio Length = 433 Score = 35.1 bits (77), Expect = 0.31 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ C+VCL + P + CGH +C C+ Sbjct: 10 QFSCSVCLDILKGPVTIPCGHSYCMSCI 37 >UniRef50_UPI000069FE11 Cluster: UPI000069FE11 related cluster; n=1; Xenopus tropicalis|Rep: UPI000069FE11 UniRef100 entry - Xenopus tropicalis Length = 522 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E DC++C P L CGH +C C+ Sbjct: 9 ELDCSICHDLYTEPVTLRCGHSYCLACI 36 >UniRef50_UPI00004D3D5B Cluster: UPI00004D3D5B related cluster; n=3; Xenopus tropicalis|Rep: UPI00004D3D5B UniRef100 entry - Xenopus tropicalis Length = 460 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E +C+VCL P L CGH FC C+ Sbjct: 9 ELNCSVCLNVYTDPVMLICGHNFCRTCI 36 >UniRef50_UPI000065F6EB Cluster: Homolog of Brachydanio rerio "Bloodthirsty.; n=1; Takifugu rubripes|Rep: Homolog of Brachydanio rerio "Bloodthirsty. - Takifugu rubripes Length = 573 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 157 LKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + AVL+ +++ C +C P + CGH FCF C+ Sbjct: 1 MSSAVLL--SEVQFQCFICQNVFCEPVSIPCGHSFCFSCI 38 >UniRef50_Q6IRC4 Cluster: MGC78802 protein; n=2; Xenopus|Rep: MGC78802 protein - Xenopus laevis (African clawed frog) Length = 461 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL P + CGH FC C+ Sbjct: 15 ELTCPICLDHFSEPVSIECGHSFCRTCI 42 >UniRef50_Q5EVY2 Cluster: TRIM41; n=1; Gallus gallus|Rep: TRIM41 - Gallus gallus (Chicken) Length = 589 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+CL P + CGH FC +C+ Sbjct: 26 CAICLDYFVEPVSIGCGHNFCRVCI 50 >UniRef50_Q4SQS6 Cluster: Chromosome undetermined SCAF14531, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF14531, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 379 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C VCL+ ++P LSCGH FC C+ Sbjct: 18 CPVCLEVYRNPHLLSCGHNFCKTCL 42 >UniRef50_Q4RNB8 Cluster: Chromosome 1 SCAF15015, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 1 SCAF15015, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 142 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCV 276 +C +CL P +SCGH FC CV Sbjct: 5 ECPICLFLMSEPVTVSCGHTFCRRCV 30 >UniRef50_Q1RLT3 Cluster: Si:ch211-154o6.7 protein; n=7; Danio rerio|Rep: Si:ch211-154o6.7 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 523 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++E C+VCL P LSC H FC C+ Sbjct: 35 SLEIKCSVCLSDFTDPVTLSCEHSFCRQCI 64 >UniRef50_Q08C26 Cluster: Zgc:153732; n=4; Danio rerio|Rep: Zgc:153732 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 562 Score = 35.1 bits (77), Expect = 0.31 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++ C++CL+ P CGH FC C++ Sbjct: 15 QFSCSICLEVFVEPVSTPCGHTFCKACLE 43 >UniRef50_A4VCF7 Cluster: Zgc:85925 protein; n=5; Euteleostomi|Rep: Zgc:85925 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 678 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CLQ P CGH +CF C+ Sbjct: 43 ELVCHICLQPLLQPMDTPCGHTYCFQCL 70 >UniRef50_Q3TU94 Cluster: 18 days pregnant adult female placenta and extra embryonic tissue cDNA, RIKEN full-length enriched library, clone:3830402B11 product:Zinc finger protein 147 (Tripartite motif protein 25) (Estrogen responsive finger protein) (Efp) homolog; n=5; Murinae|Rep: 18 days pregnant adult female placenta and extra embryonic tissue cDNA, RIKEN full-length enriched library, clone:3830402B11 product:Zinc finger protein 147 (Tripartite motif protein 25) (Estrogen responsive finger protein) (Efp) homolog - Mus musculus (Mouse) Length = 601 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C+VCL+ + P CGH FC C+ Sbjct: 10 ELSCSVCLELFKEPVTTPCGHNFCMSCL 37 >UniRef50_Q8RXF2 Cluster: Putative uncharacterized protein At3g58030; n=3; Arabidopsis thaliana|Rep: Putative uncharacterized protein At3g58030 - Arabidopsis thaliana (Mouse-ear cress) Length = 436 Score = 35.1 bits (77), Expect = 0.31 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +DC +CL + P CGH++C+ C+ Sbjct: 137 FDCNICLDLSKEPVLTCCGHLYCWPCL 163 >UniRef50_Q25AG8 Cluster: B1011H02.2 protein; n=3; Oryza sativa|Rep: B1011H02.2 protein - Oryza sativa (Rice) Length = 253 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 N +DC +CL P CGH++C+ C+ Sbjct: 34 NACFDCNICLDFAAEPVVTLCGHLYCWPCI 63 >UniRef50_A7Q035 Cluster: Chromosome chr8 scaffold_41, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr8 scaffold_41, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 332 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLC 273 C++CL +P LSCGH+FC C Sbjct: 228 CSICLDTLFNPHALSCGHLFCKSC 251 >UniRef50_A4S4V7 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 192 Score = 35.1 bits (77), Expect = 0.31 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +++C VC + + P CGH++C+ C+ Sbjct: 70 KFECNVCFEVAREPVVTPCGHLYCWRCI 97 >UniRef50_Q7QSA4 Cluster: GLP_663_7971_12074; n=1; Giardia lamblia ATCC 50803|Rep: GLP_663_7971_12074 - Giardia lamblia ATCC 50803 Length = 1367 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 169 VLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLC 273 VL + ++ C+ C Q +HP +L CGH+ C C Sbjct: 1045 VLFRTGARDFLCSACSQVVRHPCRLRCGHLVCRSC 1079 Score = 34.7 bits (76), Expect = 0.41 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 157 LKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 L+ V ++ Y C VC P CGH FC C+ Sbjct: 222 LQQVVKVYGLERRYFCRVCHDPFVKPMTTKCGHTFCAACI 261 Score = 33.9 bits (74), Expect = 0.72 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLC 273 ++ C C Q + P KL CGH +C+ C Sbjct: 610 DFCCVGCKQLLRLPVKLKCGHFYCYNC 636 >UniRef50_Q7QI38 Cluster: ENSANGP00000020505; n=2; Culicidae|Rep: ENSANGP00000020505 - Anopheles gambiae str. PEST Length = 302 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCV 276 +CA+C+ Q T CGH+FC+ C+ Sbjct: 241 NCALCMDTAQAITVTQCGHLFCWQCI 266 >UniRef50_Q7QDJ7 Cluster: ENSANGP00000015141; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000015141 - Anopheles gambiae str. PEST Length = 143 Score = 35.1 bits (77), Expect = 0.31 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 +C +CL+ P ++CGH FC +C++ Sbjct: 49 ECPICLEDYSAPVIVNCGHSFCSVCIQ 75 >UniRef50_Q54ND8 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 281 Score = 35.1 bits (77), Expect = 0.31 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +C P CGH+FC+ C+ Sbjct: 71 FECNICFDDVSEPVVTQCGHLFCWTCI 97 >UniRef50_Q4QAJ3 Cluster: Putative uncharacterized protein; n=4; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 394 Score = 35.1 bits (77), Expect = 0.31 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLS-CGHVFCFLC 273 E CAVCL + P +L CGH+FC C Sbjct: 13 ELTCAVCLDSWKDPVELMPCGHIFCKAC 40 >UniRef50_Q4QAJ2 Cluster: Putative uncharacterized protein; n=2; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 334 Score = 35.1 bits (77), Expect = 0.31 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLS-CGHVFCFLC 273 E CAVCL + P +L CGH+FC C Sbjct: 13 ELTCAVCLDSWKDPVELMPCGHIFCKAC 40 >UniRef50_Q4DYQ0 Cluster: Putative uncharacterized protein; n=1; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 214 Score = 35.1 bits (77), Expect = 0.31 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ CA+C P CGH+FC+ C+ Sbjct: 5 DFSCAICYDLASEPVVTRCGHLFCWNCL 32 >UniRef50_A7SSY6 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 190 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 + C++C + P + +C HVFC+ C+KV Sbjct: 152 HQCSICSEPPTAPHQGACEHVFCYYCIKV 180 >UniRef50_A7RVL2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 214 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 199 DCAVCLQKCQHPTK-LSCGHVFCFLCVK 279 +C+VCL++ H +K L C H FC C+K Sbjct: 13 ECSVCLERLDHTSKVLPCQHTFCRRCLK 40 >UniRef50_A7RRQ3 Cluster: Predicted protein; n=5; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 270 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E +C +CL++ + P L C H FC+ C+ Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECL 40 >UniRef50_A2FG27 Cluster: Ser/Thr protein phosphatase, putative; n=1; Trichomonas vaginalis G3|Rep: Ser/Thr protein phosphatase, putative - Trichomonas vaginalis G3 Length = 644 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -1 Query: 125 ISKLLKYVCSFVVFHNFLTFQINFGWIRTNIMCLSWSYY 9 + + YVC FV F F++ + G + +I+ + WSYY Sbjct: 523 VKDVFSYVCGFVAFTGFISDIVFAGLVYLSILNIGWSYY 561 >UniRef50_A2EJL6 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 378 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +C + + P L+CGH FC CV Sbjct: 6 CKICYNRIKKPVLLNCGHAFCASCV 30 >UniRef50_A0CSD3 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 583 Score = 35.1 bits (77), Expect = 0.31 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + DC +C +P + CGH FC C+ Sbjct: 230 QLDCVICYSSMTNPVSMKCGHSFCKACM 257 >UniRef50_A0CPP5 Cluster: Chromosome undetermined scaffold_23, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_23, whole genome shotgun sequence - Paramecium tetraurelia Length = 251 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 EY C +CLQ P CGH FC C+ Sbjct: 14 EYMCVICLQVFYKPIITQCGHNFCGKCI 41 >UniRef50_A6NK30 Cluster: Uncharacterized protein TRIM6; n=9; Eutheria|Rep: Uncharacterized protein TRIM6 - Homo sapiens (Human) Length = 470 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P + CGH FC C+ Sbjct: 12 EVTCPICLELLTEPLSIDCGHSFCQACI 39 >UniRef50_Q8TFH8 Cluster: Ubiquitin-protein ligase E3; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin-protein ligase E3 - Schizosaccharomyces pombe (Fission yeast) Length = 311 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVKV 282 C +C +K ++P LS G VFC+ C++V Sbjct: 257 CKICGEKIKNPAVLSTGFVFCYPCIQV 283 >UniRef50_Q755X8 Cluster: AER390Wp; n=1; Eremothecium gossypii|Rep: AER390Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 316 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL P+ L CGH+FC+ CV Sbjct: 266 CILCLADMTDPSCLPCGHMFCWACV 290 >UniRef50_Q9C030 Cluster: Tripartite motif-containing protein 6; n=86; Eutheria|Rep: Tripartite motif-containing protein 6 - Homo sapiens (Human) Length = 488 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P + CGH FC C+ Sbjct: 12 EVTCPICLELLTEPLSIDCGHSFCQACI 39 >UniRef50_Q9C035 Cluster: Tripartite motif-containing protein 5; n=38; Simiiformes|Rep: Tripartite motif-containing protein 5 - Homo sapiens (Human) Length = 493 Score = 35.1 bits (77), Expect = 0.31 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P L CGH FC C+ Sbjct: 12 EVTCPICLELLTQPLSLDCGHSFCQACL 39 >UniRef50_UPI000155CFC7 Cluster: PREDICTED: hypothetical protein; n=3; Ornithorhynchus anatinus|Rep: PREDICTED: hypothetical protein - Ornithorhynchus anatinus Length = 665 Score = 34.7 bits (76), Expect = 0.41 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C+VC++ P ++CGH FC +C+ Sbjct: 13 ELTCSVCMEYFIDPVTITCGHSFCQICL 40 >UniRef50_UPI000155B9C7 Cluster: PREDICTED: similar to 52 kDa Ro protein (Sjoegren syndrome type A antigen) (SS-A) (Ro(SS-A)) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (Tripartite motif-containing protein 21) (RING finger protein 81); n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to 52 kDa Ro protein (Sjoegren syndrome type A antigen) (SS-A) (Ro(SS-A)) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (Tripartite motif-containing protein 21) (RING finger protein 81) - Ornithorhynchus anatinus Length = 342 Score = 34.7 bits (76), Expect = 0.41 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P + CGH FC C+ Sbjct: 13 EMTCPICLEFSGEPMSIKCGHSFCHRCI 40 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 322,978,754 Number of Sequences: 1657284 Number of extensions: 5878781 Number of successful extensions: 17955 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 17185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17930 length of database: 575,637,011 effective HSP length: 88 effective length of database: 429,796,019 effective search space used: 10315104456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -