BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h12f (338 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0961 + 9566730-9566998,9567096-9567187,9567294-9567427,956... 41 2e-04 07_03_1651 - 28395369-28395436,28395524-28395575,28395857-283960... 40 7e-04 08_02_1329 - 26182762-26183007,26183149-26183249,26183533-261836... 39 0.001 07_03_1304 - 25629822-25629839,25630091-25631148,25631784-256349... 38 0.003 01_06_1819 + 40110697-40110721,40110818-40110828,40111228-401115... 38 0.003 08_01_0413 - 3679887-3681254 37 0.005 02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501... 37 0.005 01_06_0829 - 32270189-32270863 37 0.005 05_05_0173 + 22956927-22958615 36 0.006 01_06_1224 - 35508842-35510404 36 0.011 02_04_0653 - 24747959-24748276,24748847-24748959,24749815-247500... 35 0.014 03_05_0677 + 26663880-26664581 35 0.019 03_05_0513 - 25073518-25073623,25073719-25073777,25074048-250741... 35 0.019 02_05_0084 - 25690346-25691206 35 0.019 12_02_1243 + 27300978-27301682 34 0.033 05_03_0471 - 14455543-14455650,14455925-14456002,14456121-144562... 33 0.043 05_01_0018 + 125697-126130,126231-126356,126726-126825,126950-12... 33 0.043 04_04_1247 - 32043776-32043880,32044296-32044505,32044595-320451... 33 0.043 01_01_0475 + 3500385-3500880,3501078-3501154,3501851-3502019,350... 33 0.043 09_04_0706 + 19627024-19627380,19629945-19629976,19630657-196307... 32 0.100 04_03_0205 + 12649724-12650191,12651493-12652025,12652114-126522... 31 0.23 01_06_1809 - 40029628-40030539 31 0.23 08_02_1334 - 26224546-26225337 31 0.30 02_05_0890 - 32546918-32547088,32547224-32547334,32547705-325478... 31 0.30 07_03_1459 + 26681619-26682419,26682600-26682912,26683861-26684672 30 0.53 01_06_1720 + 39421381-39421444,39422424-39422601,39422812-394229... 30 0.53 09_04_0651 - 19224403-19225032 29 0.70 07_01_1116 + 10308029-10308111,10308575-10308737,10308996-103090... 29 0.70 11_01_0019 + 135610-136296,136736-137275,137367-137518,137683-13... 29 1.2 05_01_0462 - 3658153-3658290,3658394-3658540,3658622-3658720,365... 29 1.2 01_06_0919 - 32993752-32993856,32994383-32994592,32994666-329952... 29 1.2 03_02_0568 + 9514715-9514944,9515174-9515300,9515529-9515684,951... 28 1.6 11_04_0312 - 16259612-16260231,16260264-16262796 28 2.1 09_04_0144 + 15071723-15071993,15072078-15072632,15072671-150726... 28 2.1 02_05_0713 + 31159574-31160764 27 2.8 12_01_0018 + 132654-133304,133726-134265,134357-134436,134673-13... 27 3.8 10_08_0663 - 19666476-19667017,19667664-19667755,19668039-196680... 27 3.8 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 27 3.8 07_03_1762 - 29299328-29299437,29299782-29299871,29300487-293012... 27 3.8 07_03_1375 + 26120094-26120651 27 3.8 06_02_0066 - 11081446-11081544,11081639-11081846,11083122-110832... 27 3.8 03_02_0715 + 10621789-10623243,10624074-10625018 27 3.8 03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 27 3.8 03_01_0542 + 4071906-4072241,4073093-4073184,4073275-4073317,407... 27 3.8 04_04_0995 + 29985473-29985625,29986372-29986446,29986537-299870... 27 5.0 04_04_0994 + 29980076-29980441,29980900-29980998,29981075-299816... 27 5.0 12_02_1214 - 27061794-27062178,27063018-27063766,27064427-27064831 26 6.6 11_01_0110 + 850780-850805,851465-851537,851558-851720,851947-85... 26 6.6 09_03_0128 + 12584166-12585320 26 6.6 08_02_0662 + 19789406-19789546,19789646-19789779,19790272-197904... 26 6.6 08_01_0961 - 9622444-9622928,9623011-9623102,9623862-9624002,962... 26 6.6 08_01_0540 + 4691929-4692014,4692915-4693125,4693756-4693885,469... 26 6.6 02_05_0391 + 28563242-28563302,28563714-28563931,28564563-285646... 26 6.6 02_03_0366 + 18210333-18210531,18210704-18210751,18211099-182112... 26 6.6 12_02_0895 + 24094809-24094886,24097197-24097402,24097493-24097919 26 8.7 10_08_0961 + 21869612-21869773,21869869-21869956,21870047-218702... 26 8.7 09_04_0521 - 18297343-18297840 26 8.7 06_01_1173 + 10014391-10014678,10015478-10017245,10017333-100174... 26 8.7 >12_01_0961 + 9566730-9566998,9567096-9567187,9567294-9567427, 9567542-9567591,9569026-9569100,9569179-9569734 Length = 391 Score = 41.1 bits (92), Expect = 2e-04 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E CA+CL+ C P+ CGH FC C+K Sbjct: 161 ELSCAICLEICFEPSTTPCGHSFCMKCLK 189 >07_03_1651 - 28395369-28395436,28395524-28395575,28395857-28396092, 28396362-28396419,28396509-28396577,28396686-28396791, 28397104-28397171,28397266-28397385,28398144-28398231, 28399433-28399534,28399699-28399757,28399866-28400003, 28400222-28400473,28400508-28400593,28401061-28401165, 28402351-28402516 Length = 590 Score = 39.5 bits (88), Expect = 7e-04 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLC 273 C++CL P LSCGH++C+LC Sbjct: 199 CSICLDTVFDPVALSCGHIYCYLC 222 >08_02_1329 - 26182762-26183007,26183149-26183249,26183533-26183602, 26183692-26183895,26186435-26186941,26188672-26188677 Length = 377 Score = 38.7 bits (86), Expect = 0.001 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C VCL K P+ +CGH+FC C++ Sbjct: 317 FTCPVCLNKLDKPSTTNCGHIFCEKCIQ 344 >07_03_1304 - 25629822-25629839,25630091-25631148,25631784-25634928, 25635454-25636293 Length = 1686 Score = 37.5 bits (83), Expect = 0.003 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKL-SCGHVFCFLCV 276 +E C +CL + + P KL SCGHVFC C+ Sbjct: 1520 LENACPICLCEVEDPFKLESCGHVFCLTCL 1549 >01_06_1819 + 40110697-40110721,40110818-40110828,40111228-40111572, 40111707-40111782,40113605-40113771,40113818-40114036 Length = 280 Score = 37.5 bits (83), Expect = 0.003 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++C VC+ + P+ CGH+FC C+K Sbjct: 223 FNCPVCMNELVEPSSTICGHIFCKQCIK 250 >08_01_0413 - 3679887-3681254 Length = 455 Score = 36.7 bits (81), Expect = 0.005 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 N ++C +C + + P CGH+FC+ C+ Sbjct: 236 NGSFECNICFESAKDPVVTPCGHLFCWPCI 265 >02_03_0412 - 18749430-18749587,18749696-18749857,18750062-18750194, 18751640-18751744,18751818-18751935,18752232-18752320, 18752407-18753660,18753785-18753831,18754285-18754339, 18754783-18754884 Length = 740 Score = 36.7 bits (81), Expect = 0.005 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E C +CL+ P SCGH++CF C+ Sbjct: 229 EVQCPICLESPLCPQITSCGHIYCFPCI 256 >01_06_0829 - 32270189-32270863 Length = 224 Score = 36.7 bits (81), Expect = 0.005 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +CL+ Q P CGH+FC+ C+ Sbjct: 25 FECNICLELAQDPVVTLCGHLFCWPCL 51 >05_05_0173 + 22956927-22958615 Length = 562 Score = 36.3 bits (80), Expect = 0.006 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +C + P SCGH+FC+ C+ Sbjct: 236 FECNICFEMASEPVVTSCGHLFCWPCL 262 >01_06_1224 - 35508842-35510404 Length = 520 Score = 35.5 bits (78), Expect = 0.011 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +C P SCGH+FC+ C+ Sbjct: 192 FECNICFDMASEPVVTSCGHLFCWPCL 218 >02_04_0653 - 24747959-24748276,24748847-24748959,24749815-24750015, 24750097-24750267,24750354-24750425,24751515-24751543, 24752161-24752303 Length = 348 Score = 35.1 bits (77), Expect = 0.014 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + CA+C + P L+CGHV+C C+ Sbjct: 118 DVSCALCKELLYQPAVLNCGHVYCMSCL 145 >03_05_0677 + 26663880-26664581 Length = 233 Score = 34.7 bits (76), Expect = 0.019 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +C + Q P CGH+FC+ C+ Sbjct: 22 FECNICFELPQEPIVTLCGHLFCWPCI 48 >03_05_0513 - 25073518-25073623,25073719-25073777,25074048-25074185, 25074719-25074982,25075062-25075306,25075874-25076081 Length = 339 Score = 34.7 bits (76), Expect = 0.019 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Frame = +1 Query: 172 LIFSHNMEYD----CAVCLQKCQHPTKLSCGHVFCFLC 273 + S M+Y+ C +CL +P LSCGH+FC C Sbjct: 221 MAISETMKYEYSLTCPICLDTLFNPYALSCGHLFCKGC 258 >02_05_0084 - 25690346-25691206 Length = 286 Score = 34.7 bits (76), Expect = 0.019 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +DC +CL P CGH++C+ C+ Sbjct: 49 FDCNICLDFATEPVVTLCGHLYCWPCI 75 >12_02_1243 + 27300978-27301682 Length = 234 Score = 33.9 bits (74), Expect = 0.033 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++C +C + Q P CGH+FC+ C+ Sbjct: 23 FECNICFELPQEPIVTLCGHLFCWPCL 49 >05_03_0471 - 14455543-14455650,14455925-14456002,14456121-14456285, 14457151-14457261,14457863-14458024,14458462-14458538, 14459526-14460177 Length = 450 Score = 33.5 bits (73), Expect = 0.043 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+C +K P L C H+FC CV Sbjct: 423 CAICQEKMHVPVLLRCKHIFCEDCV 447 >05_01_0018 + 125697-126130,126231-126356,126726-126825,126950-126969, 127118-127220,127331-127469,127577-127791,127873-128523 Length = 595 Score = 33.5 bits (73), Expect = 0.043 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E+ C++C Q + P C H FC LC+ Sbjct: 308 EFGCSICKQVMKEPLTTPCAHNFCKLCL 335 >04_04_1247 - 32043776-32043880,32044296-32044505,32044595-32045101, 32045362-32045583,32046054-32046184,32046737-32047745, 32047830-32047904,32047995-32048066,32048153-32048328, 32048494-32048646,32048739-32049234 Length = 1051 Score = 33.5 bits (73), Expect = 0.043 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +1 Query: 160 KHAVLIFSHNMEYDCAVCLQKCQHPTK----LSCGHVFCFLCV 276 K V+ +E D A+C +C P + +CGHVFC+ CV Sbjct: 757 KETVINLLGQLEGDYAIC-SRCSDPPEDVVVATCGHVFCYQCV 798 >01_01_0475 + 3500385-3500880,3501078-3501154,3501851-3502019, 3502385-3502473,3502601-3502765,3502841-3502918, 3503087-3503190,3503317-3503422 Length = 427 Score = 33.5 bits (73), Expect = 0.043 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+C +K P L C H+FC CV Sbjct: 366 CAICQEKMHTPILLRCKHIFCEDCV 390 >09_04_0706 + 19627024-19627380,19629945-19629976,19630657-19630751, 19632116-19632281,19632881-19632938,19633014-19633061, 19633274-19633464,19633580-19633702,19635174-19635289, 19635841-19635924,19636009-19636259,19636438-19636647 Length = 576 Score = 32.3 bits (70), Expect = 0.100 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +C + P+ L+CGHV+C C+ Sbjct: 406 CLICQELLFDPSVLNCGHVYCMPCL 430 >04_03_0205 + 12649724-12650191,12651493-12652025,12652114-12652239, 12652625-12652724,12652880-12652899,12653035-12653137, 12653213-12653351,12653448-12653662,12653772-12654320 Length = 750 Score = 31.1 bits (67), Expect = 0.23 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 N +C+ C+ + P CGH FC C + Sbjct: 139 NKNINCSFCMLLPERPVTTPCGHNFCLKCFR 169 Score = 29.5 bits (63), Expect = 0.70 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E+ C++C + P C H FC C+ Sbjct: 497 EFRCSICRNVMEEPVTTPCAHNFCKKCL 524 >01_06_1809 - 40029628-40030539 Length = 303 Score = 31.1 bits (67), Expect = 0.23 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 190 MEYDCAVCLQKCQHPTKLSCGHVFCFLC 273 M + C VC+ + + + CGH FC LC Sbjct: 251 MVHVCCVCMVRHKGAAFIPCGHTFCRLC 278 >08_02_1334 - 26224546-26225337 Length = 263 Score = 30.7 bits (66), Expect = 0.30 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C VC+ + + + CGH FC C + Sbjct: 215 CCVCMARAKGAAFIPCGHTFCRTCAR 240 >02_05_0890 - 32546918-32547088,32547224-32547334,32547705-32547884, 32547960-32548064,32548333-32548431,32548524-32548679, 32548772-32548850,32549213-32549278,32549382-32549536, 32549675-32550034,32550150-32550305,32550779-32550856, 32551471-32551812 Length = 685 Score = 30.7 bits (66), Expect = 0.30 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +C+ + +CGH FC++C+ Sbjct: 60 CPICMAVIKDAFLTACGHSFCYMCI 84 >07_03_1459 + 26681619-26682419,26682600-26682912,26683861-26684672 Length = 641 Score = 29.9 bits (64), Expect = 0.53 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +1 Query: 154 VLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +LK + +++C +CL SC H++C C+ Sbjct: 379 LLKKLASLVDDGDDFECPICLAPPAKTVITSCTHIYCQTCI 419 >01_06_1720 + 39421381-39421444,39422424-39422601,39422812-39422980, 39423101-39423170,39423259-39423487,39425130-39425340 Length = 306 Score = 29.9 bits (64), Expect = 0.53 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E +C +CL+ C +C H C C + Sbjct: 207 EDECGICLETCTKMVLPNCNHAMCINCYR 235 >09_04_0651 - 19224403-19225032 Length = 209 Score = 29.5 bits (63), Expect = 0.70 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C VC+ + + + CGH FC C + Sbjct: 161 CCVCMARGKAAAFIPCGHTFCRACAR 186 >07_01_1116 + 10308029-10308111,10308575-10308737,10308996-10309062, 10309120-10309375,10309658-10309781,10310039-10310077 Length = 243 Score = 29.5 bits (63), Expect = 0.70 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E +C +C++ C +C H C C + Sbjct: 160 EDECGICMETCTKMVLPNCSHAMCIKCYR 188 >11_01_0019 + 135610-136296,136736-137275,137367-137518,137683-137959 Length = 551 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +1 Query: 154 VLKHAVLIFSHNMEYDCAVCLQKCQ----HPTKLSCGHVFCFLCVK 279 + K AV+ + +C +CL+ H + C H FCF C+K Sbjct: 283 IAKAAVVSAGKEKKENCTICLEDTDVSKIHAVE-GCAHRFCFSCMK 327 >05_01_0462 - 3658153-3658290,3658394-3658540,3658622-3658720, 3658802-3659253,3659597-3660280,3662072-3662180 Length = 542 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = +1 Query: 151 CVLKHAVLIFSHNMEYD----CAVCLQKCQHPT---KLSCGHVFCFLCVK 279 CV++ A SH + C +CL++ +H +L CGH F C+K Sbjct: 472 CVMEVACCSSSHLQDDQDNERCVICLEEYKHEDTLGRLKCGHGFHCNCIK 521 >01_06_0919 - 32993752-32993856,32994383-32994592,32994666-32995220, 32995705-32995926,32996381-32996511,32997456-32998353, 32998453-32998530,32998612-32998683,32998728-32998763, 32999413-33000353,33000531-33000659,33000751-33000894, 33000994-33001060,33002434-33002502,33003144-33003278 Length = 1263 Score = 28.7 bits (61), Expect = 1.2 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 160 KHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 + ++L+ + CA+C + CGHVFC C+ Sbjct: 956 QQSLLVCLQSCSAICALCNDAPEDAVVTICGHVFCNQCI 994 >03_02_0568 + 9514715-9514944,9515174-9515300,9515529-9515684, 9515765-9516102,9516191-9516329,9517083-9517152, 9517201-9517307,9517387-9517437,9517549-9517660, 9517783-9517869,9517958-9518133,9518479-9518586, 9518654-9518812,9518888-9518971,9519053-9519258, 9519565-9519666,9519768-9519877,9519963-9520114, 9520380-9520548,9520841-9520878,9521963-9522571, 9523314-9523784,9523786-9523871,9524396-9524906, 9525388-9525412,9526001-9526051,9526228-9526301, 9526412-9526534,9526667-9526738,9526924-9527020, 9527174-9527283 Length = 1649 Score = 28.3 bits (60), Expect = 1.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +CL+ HP GH FC C+ Sbjct: 1185 CCLCLKPLIHPLCCPKGHTFCKECI 1209 >11_04_0312 - 16259612-16260231,16260264-16262796 Length = 1050 Score = 27.9 bits (59), Expect = 2.1 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 221 FCKQTAQSYSILCEKINTACLSTHKLSHTYLPISKLLKYVC 99 FC+Q A Y I +KIN + ++S I KL VC Sbjct: 511 FCEQFAAPYEIAEDKINEKFKTCKRVSFINTSIEKLTAPVC 551 >09_04_0144 + 15071723-15071993,15072078-15072632,15072671-15072681, 15072954-15073012,15073962-15074040 Length = 324 Score = 27.9 bits (59), Expect = 2.1 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLS---CGHVFCFLCV 276 + C+VC++K Q + + C H FC C+ Sbjct: 108 FKCSVCMEKLQVSEQFTVSFCAHAFCNSCI 137 >02_05_0713 + 31159574-31160764 Length = 396 Score = 27.5 bits (58), Expect = 2.8 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 142 DNLCVLKHAVLIFSHNMEYDCAVCLQKCQHPTKLS----CGHVFCFLCV 276 D L V + ++ +DCAVCL + +L CGH F C+ Sbjct: 132 DALPVFAYRDIVGGDKEPFDCAVCLCEFDGEDRLRLLPVCGHAFHLHCI 180 >12_01_0018 + 132654-133304,133726-134265,134357-134436,134673-134949 Length = 515 Score = 27.1 bits (57), Expect = 3.8 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +1 Query: 154 VLKHAVLIFSHNMEYDCAVCLQKCQ----HPTKLSCGHVFCFLCVK 279 + K A + + +C +CL+ H + C H FCF C+K Sbjct: 271 IAKAAAVSAGKEKKENCTICLEDTDVSKIHAVE-GCAHRFCFSCMK 315 >10_08_0663 - 19666476-19667017,19667664-19667755,19668039-19668095, 19668304-19668447,19668567-19668613,19668733-19668791, 19668975-19669045,19669274-19669341,19669431-19669598, 19669885-19669944,19670075-19670251 Length = 494 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLC 273 CAVCL++ C H FC C Sbjct: 301 CAVCLERSCSVAAEGCCHEFCIKC 324 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHV-FCFLCVKV 282 +C +CL + + T L C H+ C C KV Sbjct: 343 ECVICLSEPRDTTVLPCRHMCMCSECAKV 371 >07_03_1762 - 29299328-29299437,29299782-29299871,29300487-29301291, 29301956-29303278 Length = 775 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +1 Query: 202 CAVCLQKCQHPTKLS----CGHVFCFLCV 276 C +CL + Q T C H FCF C+ Sbjct: 369 CGICLSEEQRATIQGVLNCCAHYFCFACI 397 >07_03_1375 + 26120094-26120651 Length = 185 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVK 279 DCA+CL ++ CGH F C++ Sbjct: 88 DCAICLDAFAAGKEMPCGHRFHSECLE 114 >06_02_0066 - 11081446-11081544,11081639-11081846,11083122-11083257, 11083339-11083541,11083616-11083765,11083848-11083964, 11084623-11085119 Length = 469 Score = 27.1 bits (57), Expect = 3.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +C ++ KL CGH+F C++ Sbjct: 260 CIICREEMTTAKKLLCGHLFHVHCLR 285 >03_02_0715 + 10621789-10623243,10624074-10625018 Length = 799 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +1 Query: 202 CAVCLQKCQHPTKLS----CGHVFCFLCV 276 C +CL + Q T C H FCF C+ Sbjct: 413 CGICLSEEQRVTVQGVLDCCSHYFCFACI 441 >03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 Length = 430 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHV-FCFLCVKV 282 +C +CL + + T L C H+ C C KV Sbjct: 338 ECVICLSEPRDTTVLPCRHMCMCSECAKV 366 >03_01_0542 + 4071906-4072241,4073093-4073184,4073275-4073317, 4073601-4073720,4073785-4073949,4074042-4074163, 4074357-4074476,4074645-4074936 Length = 429 Score = 27.1 bits (57), Expect = 3.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFC 264 C +CL+K + + CGH+ C Sbjct: 377 CVICLRKRRKAAFIPCGHLVC 397 >04_04_0995 + 29985473-29985625,29986372-29986446,29986537-29987044, 29987349-29987734,29988418-29988641,29988728-29988893, 29989095-29989226 Length = 547 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 196 YDCAVCLQKCQHPT--KLSCGHVFCFLCVK 279 +DC +C + KL CGH FC C++ Sbjct: 235 HDCMICFTERAGIDFIKLPCGHYFCQRCME 264 >04_04_0994 + 29980076-29980441,29980900-29980998,29981075-29981612, 29982211-29982494,29983014-29983034,29983238-29983452, 29983538-29983691,29984089-29984220 Length = 602 Score = 26.6 bits (56), Expect = 5.0 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +1 Query: 196 YDCAVCLQKCQHP--TKLSCGHVFCFLCVK 279 +DC +C + KL C H FC C++ Sbjct: 324 HDCMICFSEFPGTDFVKLPCHHFFCLKCMQ 353 >12_02_1214 - 27061794-27062178,27063018-27063766,27064427-27064831 Length = 512 Score = 26.2 bits (55), Expect = 6.6 Identities = 8/27 (29%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 202 CAVCLQKCQ--HPTKLSCGHVFCFLCV 276 C++C ++ + K+ C H FC+ C+ Sbjct: 198 CSICCEEKRGAQMIKVGCAHTFCYSCL 224 >11_01_0110 + 850780-850805,851465-851537,851558-851720,851947-852260, 852330-852409,852506-852848,853068-853166,853240-853360, 853567-853723,853976-854099,855275-855368,855866-857259, 857882-857924,858240-858458,859379-859605,859701-859948, 860246-860552,860725-861153 Length = 1486 Score = 26.2 bits (55), Expect = 6.6 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = -1 Query: 308 FKKNNKIFQTFTQRKQKT*PQDSFVGC*HFCK----QTAQSYSILCEKINTACLSTHKLS 141 F K +IF Q ++ QDSFVG K +++Q +L E++ L K Sbjct: 1212 FTKGEEIFCKLRQLQKAIARQDSFVGLSALWKYLPTKSSQEIQMLDEQVRLLILDVAKEQ 1271 Query: 140 HTY 132 H Y Sbjct: 1272 HHY 1274 >09_03_0128 + 12584166-12585320 Length = 384 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLS----CGHVFCFLCV 276 ++DCAVCL + +L CGH F C+ Sbjct: 141 QFDCAVCLCEFDGGDRLRLLPLCGHAFHAACI 172 >08_02_0662 + 19789406-19789546,19789646-19789779,19790272-19790476, 19791233-19791367,19792117-19792746,19793180-19793356, 19795175-19795198 Length = 481 Score = 26.2 bits (55), Expect = 6.6 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTK-LSCGHVFCFLCVK 279 E C +C L CGH FC+ C++ Sbjct: 380 ELSCVICWTDFSSTRGILPCGHRFCYSCIQ 409 >08_01_0961 - 9622444-9622928,9623011-9623102,9623862-9624002, 9624460-9624506,9624581-9624639,9624780-9624940, 9625021-9625196,9625284-9625355,9625820-9625879, 9625997-9626191 Length = 495 Score = 26.2 bits (55), Expect = 6.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLC 273 CA+CL + CGH FC C Sbjct: 321 CAICLDTECTVSAEGCGHEFCTKC 344 >08_01_0540 + 4691929-4692014,4692915-4693125,4693756-4693885, 4695422-4696072,4696179-4696395,4697040-4697111, 4697167-4697257,4697367-4698363,4698914-4699044, 4699584-4699802,4700110-4700805,4700912-4701121, 4701606-4701710 Length = 1271 Score = 26.2 bits (55), Expect = 6.6 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 247 CGHVFCFLCV 276 CGHVFC+ C+ Sbjct: 1010 CGHVFCYQCI 1019 >02_05_0391 + 28563242-28563302,28563714-28563931,28564563-28564637, 28564730-28565264,28565343-28565523,28565586-28565724, 28565826-28566067,28566157-28566322,28566591-28566698 Length = 574 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 175 IFSHNMEYDCAVCLQKC--QHPTKLSCGHVFCFLCVK 279 IF+ + ++C VCL + ++ +L C H FC C++ Sbjct: 280 IFARRI-HECGVCLSENTGRNFIQLPCSHSFCVKCME 315 >02_03_0366 + 18210333-18210531,18210704-18210751,18211099-18211256, 18211932-18212045,18212688-18212771,18212886-18212942 Length = 219 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 205 AVCLQKCQHPTKLSCGHVFCFLCVKV*N 288 A CLQ+C + +SCG F F ++V N Sbjct: 77 ADCLQQCYNIVVVSCGFNFSFPKIEVAN 104 >12_02_0895 + 24094809-24094886,24097197-24097402,24097493-24097919 Length = 236 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/30 (30%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = +1 Query: 199 DCAVCLQKCQHP---TKLSCGHVFCFLCVK 279 +C++CL++C +L C H+F C++ Sbjct: 185 ECSICLERCGDADGLLELRCKHIFHSACLE 214 >10_08_0961 + 21869612-21869773,21869869-21869956,21870047-21870277, 21870371-21870538,21870808-21871001,21871151-21871234, 21871315-21871434,21871621-21871714,21871813-21871973, 21873237-21873313,21873738-21873932,21874487-21874559, 21874635-21874721,21874906-21875043,21875181-21875383, 21875469-21875631,21875861-21875992 Length = 789 Score = 25.8 bits (54), Expect = 8.7 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C VC + + C H+FC C++ Sbjct: 737 CGVCFDRPKEVVITKCFHLFCSPCIQ 762 >09_04_0521 - 18297343-18297840 Length = 165 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 199 DCAVCLQKCQHPT---KLSCGHVFCFLCVK 279 DC VCL + + +L CGH+F C++ Sbjct: 102 DCRVCLVRFEAEAVVNRLPCGHIFHRACLE 131 >06_01_1173 + 10014391-10014678,10015478-10017245,10017333-10017436, 10017632-10017706,10017887-10017918,10019396-10019482, 10020848-10021294,10021477-10021630,10022203-10022329, 10022547-10022632,10022719-10022790,10023083-10023286, 10023732-10024049 Length = 1253 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/28 (32%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +1 Query: 202 CAVCLQKCQHPTKLS---CGHVFCFLCV 276 C +CL + + C H FCF+C+ Sbjct: 27 CGICLTDARRAVRGELDCCAHHFCFVCI 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,158,898 Number of Sequences: 37544 Number of extensions: 145391 Number of successful extensions: 407 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 470052804 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -