BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h12f (338 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 54 4e-08 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.015 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 35 0.015 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 35 0.015 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.034 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 34 0.034 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.045 SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) 33 0.045 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.059 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 33 0.059 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 33 0.059 SB_11151| Best HMM Match : Neur_chan_memb (HMM E-Value=3.6e-10) 33 0.059 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.10 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 32 0.14 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.14 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.14 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.14 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 32 0.14 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 32 0.14 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.14 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.14 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 31 0.18 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 31 0.18 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 31 0.18 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 31 0.24 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 31 0.24 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 31 0.24 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.24 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 31 0.24 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 31 0.24 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.32 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.32 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.42 SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.42 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 30 0.55 SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 30 0.55 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.55 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 30 0.55 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 30 0.55 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 30 0.55 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 30 0.55 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 30 0.55 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 30 0.55 SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.73 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 0.73 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 29 0.73 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 29 0.73 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 0.73 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.73 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 0.73 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.73 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.73 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 29 0.73 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 29 0.73 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 29 0.73 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.73 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 29 0.73 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.73 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.73 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.96 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 29 1.3 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 29 1.3 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 28 1.7 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.7 SB_7039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.7 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 28 1.7 SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 28 2.2 SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 28 2.2 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 28 2.2 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 27 2.9 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.9 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 27 2.9 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.9 SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.9 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.9 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_16197| Best HMM Match : zf-CCHC (HMM E-Value=0.19) 27 5.1 SB_51890| Best HMM Match : BCCT (HMM E-Value=0) 27 5.1 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 27 5.1 SB_42336| Best HMM Match : Sushi (HMM E-Value=1.5e-08) 26 6.8 SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) 26 6.8 SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.8 SB_51713| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.8 SB_18954| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.0015) 26 6.8 SB_16806| Best HMM Match : CUE (HMM E-Value=1e-07) 26 6.8 SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) 26 6.8 SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 26 9.0 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 26 9.0 SB_40913| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 26 9.0 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 53.6 bits (123), Expect = 4e-08 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = +1 Query: 175 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 IF + + DC VCLQ+ +P +L CGH+FCFLC+K Sbjct: 62 IFELDYQPDCPVCLQQASYPVRLPCGHMFCFLCIK 96 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 35.1 bits (77), Expect = 0.015 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E +C +CL++ + P L C H FC+ C+ Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECL 40 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 35.1 bits (77), Expect = 0.015 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E++C +C + +P CGHVFC C+ Sbjct: 376 EFECTLCCRLFYNPVTTPCGHVFCRACL 403 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 35.1 bits (77), Expect = 0.015 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 E +C +CL++ + P L C H FC+ C+ Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECL 40 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 33.9 bits (74), Expect = 0.034 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 181 SHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 S N ++C +CL + CGH+FC+ C+ Sbjct: 56 SANANFECNICLDTARDAVISMCGHLFCWPCL 87 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 33.9 bits (74), Expect = 0.034 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C+VCL++ + P L C H FC C++ Sbjct: 19 ELTCSVCLEQFREPKMLPCFHTFCKECLE 47 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 33.5 bits (73), Expect = 0.045 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ C +C + P +CGHVFC C+ Sbjct: 54 DFKCGICFGVLEDPLVTTCGHVFCSQCL 81 >SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) Length = 106 Score = 33.5 bits (73), Expect = 0.045 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 + C++C + P + +C HVFC+ C+K Sbjct: 79 HQCSICSEPPTAPHQGACEHVFCYYCIK 106 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 33.1 bits (72), Expect = 0.059 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLS-CGHVFCFLCVKV*NILLFFLNK 312 EY+C +C + P ++ CGH FC C++ L F++K Sbjct: 23 EYECPICQLAFRDPIQIEECGHRFCQSCLQELRRLYVFVDK 63 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 33.1 bits (72), Expect = 0.059 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +1 Query: 154 VLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 ++ + + S + +C +CL P+ C HVFC C+ Sbjct: 49 LINQLLQVLSSGVSEECPICLDPLDDPSITRCAHVFCTGCL 89 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 33.1 bits (72), Expect = 0.059 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLC 273 ++ C +CLQ P L C H FC +C Sbjct: 34 DFTCPICLQLLVEPVVLPCEHEFCKMC 60 >SB_11151| Best HMM Match : Neur_chan_memb (HMM E-Value=3.6e-10) Length = 434 Score = 33.1 bits (72), Expect = 0.059 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -2 Query: 307 LKKITKYFKPSHKEN--RKHDRRIVLLDVDIFASKQHNHIPYYVR 179 L +T ++ H E KH +RI+++D+DIFA K H Y++ Sbjct: 2 LSHVTCVYRALHDEIIFNKHIKRIIVVDLDIFADKSPLHSSQYMK 46 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 32.3 bits (70), Expect = 0.10 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C VCL + ++P L C H FC CV+ Sbjct: 20 CPVCLGEYKNPMLLRCYHSFCLRCVQ 45 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 31.9 bits (69), Expect = 0.14 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++C +C P + CGH +C C+K Sbjct: 20 FECGLCGDFYVDPVTILCGHTYCLACIK 47 Score = 28.7 bits (61), Expect = 1.3 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +++C +C P CGH FC C+ Sbjct: 327 DFECKLCFNLLLEPVTSLCGHSFCRDCL 354 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 31.9 bits (69), Expect = 0.14 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 31.9 bits (69), Expect = 0.14 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +1 Query: 202 CAVCLQKCQHPTKLS-CGHVFCFLCV 276 C +C + +PT LS CG+VFC+ C+ Sbjct: 1201 CPLCAKVRTNPTALSTCGYVFCYPCI 1226 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 31.9 bits (69), Expect = 0.14 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+C + P C H FC LC+ Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLCI 58 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 31.9 bits (69), Expect = 0.14 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLS-CGHVFCFLCV 276 +C +CL+ +P L CGH FC C+ Sbjct: 677 ECPICLETITYPETLQGCGHTFCRPCI 703 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 31.9 bits (69), Expect = 0.14 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLS-CGHVFCFLCV 276 +C +CL+ +P L CGH FC C+ Sbjct: 752 ECPICLETITYPETLQGCGHTFCRPCI 778 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 31.9 bits (69), Expect = 0.14 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 31.9 bits (69), Expect = 0.14 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 31.5 bits (68), Expect = 0.18 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C++CL++ Q P L+C H +C C++ Sbjct: 17 CSLCLEQYQDPRVLACLHTYCRHCLE 42 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 31.5 bits (68), Expect = 0.18 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C++CL++ Q P L+C H +C C++ Sbjct: 26 CSLCLEQYQDPRVLACLHTYCRHCLE 51 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 31.5 bits (68), Expect = 0.18 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C++CL++ Q P L+C H +C C++ Sbjct: 17 CSLCLEQYQDPRVLACLHTYCRHCLE 42 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 31.1 bits (67), Expect = 0.24 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCLHCLE 40 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 31.1 bits (67), Expect = 0.24 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +CL++ Q P L+C H +C C++ Sbjct: 16 CCLCLEQYQDPRVLACLHTYCRHCLE 41 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 31.1 bits (67), Expect = 0.24 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +CL++ Q P L+C H +C C++ Sbjct: 16 CCLCLEQYQDPRVLACLHTYCRHCLE 41 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 31.1 bits (67), Expect = 0.24 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLC 273 E+ C+ C + HP CGHV C C Sbjct: 15 EFLCSYCRKVYLHPLVTGCGHVLCTKC 41 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 31.1 bits (67), Expect = 0.24 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ C VC + T L+C H FC C++ Sbjct: 368 EFSCIVCQELFIRATTLTCSHSFCEYCLQ 396 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 31.1 bits (67), Expect = 0.24 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E CA+C++ P L C H FC C++ Sbjct: 12 EVTCAICIEHFTDPRLLPCLHTFCRHCLE 40 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 30.7 bits (66), Expect = 0.32 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 157 LKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 L+ A ++ S E +C++C + P L C H FC C+ Sbjct: 83 LQMASILDSLRQEAECSLCHKTPSEPKILKCFHTFCNECL 122 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 30.7 bits (66), Expect = 0.32 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +C + + P SCGH FC C+ Sbjct: 194 CPLCRRVFKDPVITSCGHTFCQACI 218 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 30.3 bits (65), Expect = 0.42 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 CA+C + P SCGH +C C++ Sbjct: 30 CAICHIVVKDPILTSCGHSYCKCCIQ 55 >SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 30.3 bits (65), Expect = 0.42 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLC 273 N E+ CA+CL + P C H C C Sbjct: 20 NEEFHCAICLDVLEKPLSSKCQHSCCSDC 48 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 29.9 bits (64), Expect = 0.55 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 406 Score = 29.9 bits (64), Expect = 0.55 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +1 Query: 172 LIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 L+ H C C + + C HVFC+ C+K Sbjct: 344 LVLFHQARLTCPCCNTRKKDAILTKCFHVFCYECLK 379 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 29.9 bits (64), Expect = 0.55 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C++CL + Q P L+C H +C C++ Sbjct: 17 CSLCLGQYQDPRVLACLHTYCRHCLE 42 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 29.9 bits (64), Expect = 0.55 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 29.9 bits (64), Expect = 0.55 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 29.9 bits (64), Expect = 0.55 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 29.9 bits (64), Expect = 0.55 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 29.9 bits (64), Expect = 0.55 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 11 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 39 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 29.9 bits (64), Expect = 0.55 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHLNDPRVLPCLHSFCRHCLE 40 >SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL + P C H C C K Sbjct: 169 EFHCAICLDVLEKPLSSKCQHSCCSDCWK 197 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 29.5 bits (63), Expect = 0.73 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 40 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 29.5 bits (63), Expect = 0.73 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVRCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C VC Q+ P L C H FC C++ Sbjct: 62 CRVCNQRFNKPKLLHCLHSFCQSCIE 87 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 29.5 bits (63), Expect = 0.73 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 40 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL + P C H C C K Sbjct: 165 EFHCAICLDVLEKPLSSKCQHSCCSDCWK 193 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 29.5 bits (63), Expect = 0.73 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 40 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 29.5 bits (63), Expect = 0.73 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 17 EVTCSICIEHFDDPRVLPCLHSFCRHCLE 45 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL + P C H C C K Sbjct: 73 EFHCAICLDVLEKPLSSKCQHSCCSDCWK 101 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL + P C H C C K Sbjct: 313 EFHCAICLDVLEKPLSSKCQHSCCSDCWK 341 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL + P C H C C K Sbjct: 639 EFHCAICLDVLEKPLSSKCQHSCCSDCWK 667 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 29.5 bits (63), Expect = 0.73 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 196 YDCAVCLQKCQHPTKLSCGHVFCFLCVKV 282 + C +C Q P + +CGH C C ++ Sbjct: 32 FRCTICKHVLQEPLQTTCGHRICESCFEL 60 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL + P C H C C K Sbjct: 171 EFHCAICLDVLEKPLSSKCQHSCCSDCWK 199 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 29.5 bits (63), Expect = 0.73 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL + P C H C C K Sbjct: 316 EFHCAICLDVLEKPLSSKCQHSCCSDCWK 344 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 29.5 bits (63), Expect = 0.73 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 40 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 29.5 bits (63), Expect = 0.73 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 11 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 39 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 29.5 bits (63), Expect = 0.73 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +CL + + P LSC H C C++ Sbjct: 21 CPICLDEFKEPKTLSCMHDLCRKCLE 46 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 29.1 bits (62), Expect = 0.96 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSLCIEHFNDPRVLPCFHSFCRHCLE 40 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 28.7 bits (61), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLE 40 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 28.7 bits (61), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLE 40 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 28.7 bits (61), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E C++C++ P L C H FC C++ Sbjct: 132 EVTCSLCIEHFNDPRVLPCLHSFCRHCLE 160 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 28.7 bits (61), Expect = 1.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C+ C ++P +L C H FC C+K Sbjct: 18 CSACKGFYKNPKRLPCLHAFCCHCLK 43 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 28.7 bits (61), Expect = 1.3 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +C + + CGH FC +C++ Sbjct: 18 CGICAEVLERAVLTPCGHSFCGVCLE 43 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 28.3 bits (60), Expect = 1.7 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLC 273 N+ + C +C + ++P C H FC C Sbjct: 240 NLPFACIMCRKTFKNPVVTKCLHYFCEAC 268 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 28.3 bits (60), Expect = 1.7 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +1 Query: 175 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 ++ + +C++C + + P L C H FC C++ Sbjct: 11 VYELSKHLNCSLCHRLIRGPKLLPCLHSFCLACLE 45 >SB_7039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 577 Score = 28.3 bits (60), Expect = 1.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 223 CQHPTKLSCGHVFCFLCVK 279 C H T CG FC+LC+K Sbjct: 258 CNHMTCAVCGAEFCWLCMK 276 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 28.3 bits (60), Expect = 1.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 202 CAVCLQKCQHPTKLS-CGHVFCFLCV 276 C C + +P +L+ CGHV+C CV Sbjct: 1951 CPACFCEVDNPYQLATCGHVYCRGCV 1976 >SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL P C H C C K Sbjct: 115 EFHCAICLDVLGKPLSSKCQHSCCSDCWK 143 >SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 27.9 bits (59), Expect = 2.2 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKL-SCGHVFCFLCVK 279 +Y C +C + P + CGH FC C++ Sbjct: 39 DYQCPICQLPFRDPVQTRDCGHRFCESCLE 68 >SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 193 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 E+ CA+CL P C H C C K Sbjct: 115 EFHCAICLDVLGKPLSSKCQHSCCSDCWK 143 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 27.9 bits (59), Expect = 2.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +C + + P L C H +C CVK Sbjct: 659 CPICSRPFKSPKILPCLHTYCSDCVK 684 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 27.5 bits (58), Expect = 2.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 279 N+ C +C + +P L C H FC C++ Sbjct: 140 NVNLFCPLCHEMFANPRLLPCLHTFCKRCLE 170 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 27.5 bits (58), Expect = 2.9 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 187 NMEYDCAVCLQKCQHPTKLSCGHV-FCFLCVK 279 N C +CL+ ++ L+CGHV C C + Sbjct: 533 NQGTQCVICLENQRNVVLLNCGHVCSCRTCAQ 564 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 27.5 bits (58), Expect = 2.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C C+ ++P L C H FC C+ Sbjct: 15 CPKCMNAYENPKVLPCLHTFCSQCL 39 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.5 bits (58), Expect = 2.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C++C + P L C HV+C C++ Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQ 39 >SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 2.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFC 264 C VC+ + T +CGH FC Sbjct: 100 CPVCITDARFLTMTNCGHEFC 120 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 27.5 bits (58), Expect = 2.9 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = +1 Query: 160 KHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 276 +H + M C VC + P C H FC CV Sbjct: 391 RHGTTFWCIKMSTICGVCRETYTDPRVAPCLHSFCKECV 429 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 26.6 bits (56), Expect = 5.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +C + +P L C H FC C+ Sbjct: 17 CGICQETYNNPKVLPCLHSFCQNCL 41 >SB_16197| Best HMM Match : zf-CCHC (HMM E-Value=0.19) Length = 241 Score = 26.6 bits (56), Expect = 5.1 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = -1 Query: 296 NKIFQTFTQRKQKT*PQDSFVGC*HFCKQTAQSYSILCEKINTACLSTHKLSH 138 N + Q+ T +K +T Q C + + S LC N C S HKL H Sbjct: 141 NAMKQSSTHKKPQT--QSHSTACGNCGTKHDMSARSLCPAYNCECNSCHKLHH 191 >SB_51890| Best HMM Match : BCCT (HMM E-Value=0) Length = 677 Score = 26.6 bits (56), Expect = 5.1 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 146 LSHTYLPISKLLKYVCSFVVFHNFLTFQINFGWIRTNIMCLSWSYY 9 L+H L + ++ Y +F F+ F + W NI C S YY Sbjct: 300 LNHLQLKETFMINYQLRLGMFIWFVVFFYDDTWYILNIFCQSVGYY 345 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 26.6 bits (56), Expect = 5.1 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCV 276 C +C + P C H +C CV Sbjct: 18 CCICRDVLEEPLMAPCEHSYCSACV 42 >SB_42336| Best HMM Match : Sushi (HMM E-Value=1.5e-08) Length = 303 Score = 26.2 bits (55), Expect = 6.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 245 DSFVGC*HFCKQTAQSYSILCEK 177 D+ GC HFC T Y C++ Sbjct: 12 DNNGGCQHFCNNTVGGYQCYCKR 34 >SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) Length = 695 Score = 26.2 bits (55), Expect = 6.8 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +C + + CGH+ C LC++ Sbjct: 185 CKICAENNKDVRIEPCGHLMCHLCLE 210 >SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 26.2 bits (55), Expect = 6.8 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 202 CAVCLQKCQHP---TKLSCGHVFCFLCV 276 C VCL T SC HVFC C+ Sbjct: 102 CPVCLMSLSEQKLGTPNSCMHVFCLECI 129 >SB_51713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 26.2 bits (55), Expect = 6.8 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +C + + CGH+ C LC++ Sbjct: 381 CKICAENNKDVRIEPCGHLMCHLCLE 406 >SB_18954| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.0015) Length = 921 Score = 26.2 bits (55), Expect = 6.8 Identities = 11/30 (36%), Positives = 14/30 (46%), Gaps = 4/30 (13%) Frame = +1 Query: 196 YDCAVCLQKC----QHPTKLSCGHVFCFLC 273 Y C C + +HP CG V+CF C Sbjct: 281 YRCKACKKVLAYSKRHPRDHKCGEVYCFNC 310 >SB_16806| Best HMM Match : CUE (HMM E-Value=1e-07) Length = 322 Score = 26.2 bits (55), Expect = 6.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVF 261 DCA+C KL C H+F Sbjct: 90 DCAICWDNMGKARKLPCNHLF 110 >SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) Length = 259 Score = 26.2 bits (55), Expect = 6.8 Identities = 10/29 (34%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCG---HVFCFLCVK 279 C V +Q+ + ++ CG H+FC+ C+K Sbjct: 188 CQVLIQRDEGCAQMMCGNCKHIFCWHCLK 216 >SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 158 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C C + + C HVFC+ C+K Sbjct: 106 CPCCNTRKKDAILTKCFHVFCYECLK 131 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 145 NLCVLKHAVLIFSHNM 192 NL +L+H +LIF HN+ Sbjct: 359 NLLILRHHLLIFRHNL 374 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 145 NLCVLKHAVLIFSHNM 192 NL +L+H +LIF HN+ Sbjct: 394 NLIILRHHLLIFRHNL 409 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 145 NLCVLKHAVLIFSHNM 192 NL +L+H +LIF HN+ Sbjct: 471 NLLILRHHLLIFRHNL 486 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 25.8 bits (54), Expect = 9.0 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 202 CAVCLQKCQHPTKLSCGHVFCFLCVK 279 C +C+ ++ CGH FC C++ Sbjct: 18 CNICVGVLENAITTICGHSFCESCLE 43 >SB_40913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 25.8 bits (54), Expect = 9.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 328 TGLYFVYLKKITKYFKPSHKENRKHDRRIVLLD 230 TG+ YL KY KP N K R LLD Sbjct: 475 TGILDRYLTNKPKYVKPLQYSNEKVKRYCTLLD 507 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 25.8 bits (54), Expect = 9.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 199 DCAVCLQKCQHPTKLSCGHVFCFLCVKV*NIL 294 +C C + P L C H FC C+ +IL Sbjct: 15 NCRACHKVFTEPKILDCLHTFCQKCLGTHDIL 46 >SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) Length = 562 Score = 25.8 bits (54), Expect = 9.0 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 134 YLPISKLLKYVCSFVVFHNFLTFQ 63 Y+P LL Y+CSF F+N+ T Q Sbjct: 29 YIPAVILLAYICSF-AFNNWETAQ 51 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,150,679 Number of Sequences: 59808 Number of extensions: 186833 Number of successful extensions: 613 Number of sequences better than 10.0: 96 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 613 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 485763447 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -