BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h11r (767 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc... 27 3.9 SPCC18B5.08c |||isoleucine-tRNA ligase|Schizosaccharomyces pombe... 25 9.0 >SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 26.6 bits (56), Expect = 3.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 185 VEVLYNFFYTNLRQ*FFYYIYELFECAIRDFHQIELEV 72 VE L N F+ N++ F Y F+C + F +E ++ Sbjct: 246 VEFLINSFFINVQTNLFVYHPHFFKCRLEIFLAMENQI 283 >SPCC18B5.08c |||isoleucine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 25.4 bits (53), Expect = 9.0 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 256 LDKYLELIHL*CFCNSVRDCKGGHTDIIEPLKLTTSYFVNSFVSSTLF 399 +DK L L+ L F +R+ ++ I + +YF+NSF+SST F Sbjct: 715 IDK-LALVQLDKFQTEIRELYESYS--INKVVHHLNYFMNSFLSSTYF 759 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,869,854 Number of Sequences: 5004 Number of extensions: 56508 Number of successful extensions: 92 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -