BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h11r (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0436 + 25186144-25187915,25188020-25188077,25188472-25188888 32 0.58 05_05_0230 - 23476919-23477372,23477656-23477695,23478578-234787... 29 4.1 07_01_0996 - 8390744-8391361 28 7.1 >04_04_0436 + 25186144-25187915,25188020-25188077,25188472-25188888 Length = 748 Score = 31.9 bits (69), Expect = 0.58 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 247 HTKLDKYLELIHL*CFCNSVRDCKGGHTDIIEPLKLTTSYFVNSFV 384 H K + L HL C C+ V D K IE + LT + VN ++ Sbjct: 446 HEKSELTCHLEHLICVCSDVLDGKANLRKFIEEVCLTLEWTVNQYI 491 >05_05_0230 - 23476919-23477372,23477656-23477695,23478578-23478700, 23479114-23479151,23479289-23479674,23479875-23481053, 23481805-23481928,23482733-23482779 Length = 796 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +1 Query: 523 FYLMFAWMKWKQINE-GVCIKQRIISKYI 606 FY +F W+++ +NE CIKQ ++ +I Sbjct: 580 FYTLFPWVQYSAVNERSSCIKQYPVTSHI 608 >07_01_0996 - 8390744-8391361 Length = 205 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 659 FFLS*QAASLKYNLTLHMYIHTDLWRL 739 F LS A+S+ YNLTL + +H W + Sbjct: 54 FNLSAAASSIAYNLTLKLVVHNRNWAM 80 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,779,529 Number of Sequences: 37544 Number of extensions: 268035 Number of successful extensions: 408 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -