BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h10r (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 2.3 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 2.3 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 25 3.1 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 24 4.1 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 7.2 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.2 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 7.2 EF588645-1|ABQ96833.1| 161|Anopheles gambiae transposase protein. 23 9.5 EF588613-1|ABQ96804.1| 161|Anopheles gambiae transposase protein. 23 9.5 AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 23 9.5 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 23 9.5 AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CY... 23 9.5 AF283265-1|AAG15372.1| 67|Anopheles gambiae beta-hexosaminidas... 23 9.5 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 337 EQECFEKYLLELEDGGTK 284 E++ FEKYL LE GG++ Sbjct: 122 EEKPFEKYLTLLESGGSR 139 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 452 WRHRCEVLLGTGHRHHRRDNRLPPRLL 372 W H V L H H DN+ PP LL Sbjct: 465 WGHEQGVSLFASHHHSTGDNK-PPNLL 490 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 24.6 bits (51), Expect = 3.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 196 YTAGNNWGVCPNGTGALG 143 Y G G+ PNGTG LG Sbjct: 39 YGLGGFGGLAPNGTGLLG 56 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 24.2 bits (50), Expect = 4.1 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 253 RRNDHCSSGNTSCRHLLIPGGISRSIPVRYCWGRCI 360 R N H N +CR SR+ R C+ +CI Sbjct: 140 RNNFHLPKSNRNCRTAARRNHSSRNTCRRNCYQQCI 175 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 7.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 211 RNAHTRPPQEADTSRRNDHCSSGNTSCRHLLIPGGISRSIP 333 RN P EADT + + G H+LIP G+ +P Sbjct: 560 RNLDQNRP-EADTPQEAEFNFCGCGWPAHMLIPKGLPEGLP 599 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -3 Query: 366 SNYAPTPAITNRNASRNTSWN*KMAARSITRRAVVVT 256 ++ AP PAI++R SW + + T + T Sbjct: 680 ASLAPAPAISSRFGDNRPSWRPLIVPHATTTKTPTTT 716 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.4 bits (48), Expect = 7.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 211 RNAHTRPPQEADTSRRNDHCSSGNTSCRHLLIPGGISRSIP 333 RN P EADT + + G H+LIP G+ +P Sbjct: 560 RNLDQNRP-EADTPQEAEFNFCGCGWPAHMLIPKGLPEGLP 599 >EF588645-1|ABQ96833.1| 161|Anopheles gambiae transposase protein. Length = 161 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 232 GVSCEHCVLQWTYTAGNN 179 GV C +C+ + YT G N Sbjct: 22 GVKCLYCLKVFKYTKGTN 39 >EF588613-1|ABQ96804.1| 161|Anopheles gambiae transposase protein. Length = 161 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 232 GVSCEHCVLQWTYTAGNN 179 GV C +C+ + YT G N Sbjct: 22 GVKCLYCLKVFKYTKGTN 39 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 23.0 bits (47), Expect = 9.5 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 238 EADTSRRNDHCSSGN---TSCRHLL-IPGGISRSIPVRYCWGRC 357 + D+ H SS + T H+L PG + + IP C GRC Sbjct: 24 QKDSEDGGSHYSSDDCQVTPVIHVLQYPGCVPKPIPSFACIGRC 67 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 23.0 bits (47), Expect = 9.5 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 238 EADTSRRNDHCSSGN---TSCRHLL-IPGGISRSIPVRYCWGRC 357 + D+ H SS + T H+L PG + + IP C GRC Sbjct: 24 QKDSEDGGSHYSSDDCQVTPVIHVLQYPGCVPKPIPSFACIGRC 67 >AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CYP4J5 protein. Length = 153 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +1 Query: 52 RGSVSSFQILKLQRA*SKHPCMPRMSPDSRIPE 150 +G +++ I L R ++ P R PD +PE Sbjct: 98 QGCIANLHIFDLHRDPAQFPDPERFDPDRFLPE 130 >AF283265-1|AAG15372.1| 67|Anopheles gambiae beta-hexosaminidase, beta chain protein. Length = 67 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 481 AEEANRRMDRHKCRIFHY*FP 543 A+EA RR++ CR+ H P Sbjct: 36 ADEAARRLEEQTCRMNHRGIP 56 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 823,948 Number of Sequences: 2352 Number of extensions: 19543 Number of successful extensions: 56 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -