BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h10r (716 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 24 1.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.9 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 23 2.9 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 5.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.8 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 24.2 bits (50), Expect = 1.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 173 TPVVTGCVRPL*DAMLTRDPRRKPIPHVVTTTALRVI 283 TP T + L A + R+ RR P PH T RV+ Sbjct: 161 TPTPTTVQQLLRRAQIRRNERRTPDPHDETAKKPRVL 197 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 696 ISLHSLPCWRLFVHTAGWWSPHLELRPGVP 607 +SLH WR F + A +P+ + G P Sbjct: 301 LSLHGQLLWREFFYCAATKNPNFDRMQGNP 330 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 23.0 bits (47), Expect = 2.9 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 262 DHCSSGNTSCRHLL-IPGGISRSIPVRYCWGRC 357 D C + T H L PG + + IP C GRC Sbjct: 27 DECQA--TPVIHFLQYPGCVPKPIPSYACRGRC 57 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = -2 Query: 208 LQWTYTAGNNWGVCPNGTGALGCGNQET 125 L+W G WG P+ + N +T Sbjct: 283 LKWLVNWGEQWGFLPSKDSLVFVDNHDT 310 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 608 GTPGRSSRCGLHHPAVCTNSRQQGN 682 G G +S +H P V TNS N Sbjct: 490 GYDGAASTAVIHEPVVETNSSPSPN 514 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,735 Number of Sequences: 438 Number of extensions: 5211 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -