BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h10f (481 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 2.6 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 4.5 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 4.5 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 5.9 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.8 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 91 ISLHSLPCWRLFVHTAGWWSPHLELRPGVP 180 +SLH WR F + A +P+ + G P Sbjct: 297 LSLHGQLLWREFFYCAATKNPNFDKMIGNP 326 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 480 PGGISRSIPVRYCWGRC 430 PG + + IP C GRC Sbjct: 53 PGCVPKPIPSFACIGRC 69 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/32 (25%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 454 CSLLLGSVHSLNSQ*PRW*A--VISTVVSMTC 365 C++ + + S N++ PRW I ++++ C Sbjct: 23 CAICVPKITSTNNEVPRWYICYTIGVIITIGC 54 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 5.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 120 TVRAHGRVVEPASRASAWRAG 182 T+ + +V+EP S +AW+ G Sbjct: 18 TLNNYQQVMEPRSPHTAWQFG 38 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 7.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 136 AGWWSPHLELRPGV 177 AG + PH+ RPG+ Sbjct: 23 AGLYEPHVAHRPGL 36 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,350 Number of Sequences: 336 Number of extensions: 2557 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -