BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h04r (719 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 26 1.4 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.2 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 23 9.5 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 23 9.5 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 9.5 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 25.8 bits (54), Expect = 1.4 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +3 Query: 69 RGQTLELVRLGLVFLHEGMLGVAVEQLGQVSGRHLRWFPEMRRGERKAEQQVGVL 233 RGQ R+G +H ++ LG HL W P + KA + VGV+ Sbjct: 717 RGQLKVPFRVGDTIIHSKQ---SIRYLGVQIHDHLSWKPHVELSTAKALRVVGVV 768 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 266 VQPLPTYLWQLQPQHRERPDQVPVNR 343 ++P+P WQL P + P + P + Sbjct: 632 LEPVPLASWQLPPPYVTEPVEGPAKK 657 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 22 ITYTPCV*LATEGWYCAARRWNSSVL 99 + + CV L T C A RW+SSVL Sbjct: 129 VKFHACVSLETMR-NCPAERWDSSVL 153 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 22 ITYTPCV*LATEGWYCAARRWNSSVL 99 + + CV L T C A RW+SSVL Sbjct: 278 VKFHACVSLETMR-NCPAERWDSSVL 302 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.0 bits (47), Expect = 9.5 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 432 RQSAVIFNVLQQLQLFACKVWSIHSQ*ALECERS*FQRFS 551 +Q+ V++ LQQL + W Q ECE+ QR S Sbjct: 132 QQTDVLYG-LQQLHVMERNNWKETHQLIQECEQDHVQRLS 170 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,340 Number of Sequences: 2352 Number of extensions: 13069 Number of successful extensions: 34 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -