BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h03r (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.0 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.9 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 9.1 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 3.0 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -2 Query: 463 DFDSFRRSTLNLGVIGNQDRLLRSENFVRASMVSSWAHPLTLFAPTGTRI 314 D D R S LNL N +E VRA++ ++ L++PTG R+ Sbjct: 1465 DVDHVRFSPLNLNFRANVYTPDTAE--VRATLCNNGLLKQNLYSPTGKRV 1512 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 6.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 136 LLLFSLHCVLNVPKFPPCSSIPCRLRS 216 + +F LH VL FP S PC L S Sbjct: 56 IFMFLLHFVLFSFSFPFFSFAPCTLAS 82 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 175 KFPPCSSIPCRLRS*CQKRQRWNRVR 252 ++P C S P R RS + W R R Sbjct: 267 RWPSCRSPPARRRSRSTRPTSWPRSR 292 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 561,785 Number of Sequences: 2352 Number of extensions: 10907 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -