BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h03r (563 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating... 23 1.6 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 21 8.6 >S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating peptide protein. Length = 50 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 131 KCYCYFLYIVFLTSPNFHPVVQSPAGCVRNV 223 +C +FL ++ +TS P + C R+V Sbjct: 6 RCTFFFLSVILITSYFVTPTMSIKCNCKRHV 36 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/25 (32%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +2 Query: 5 LNALSDN--NISQENISIYIDLTVR 73 +N ++D NI EN+ +YI+ ++ Sbjct: 44 INDVNDGKINIEDENVQLYIECAMK 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,145 Number of Sequences: 438 Number of extensions: 3047 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -