BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h02r (308 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 1.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 4.5 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 20 5.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 20 5.9 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 20 7.8 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 20 7.8 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 1.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 185 SAANAIALGAMTVVAVGTFLFTWWQ 111 S N I LG++ + G FLF W+ Sbjct: 287 SQINGI-LGSLVAITGGCFLFRAWE 310 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.6 bits (41), Expect = 4.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 144 HNRHRA*CYSISSGCVAALRIRILGHR 224 H R + IS+GCV+ + RI +R Sbjct: 18 HQRCSRDWFRISAGCVSRISNRISRNR 44 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 20.2 bits (40), Expect = 5.9 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 145 WRSEHFSLLGG 113 W SEHF GG Sbjct: 333 WNSEHFFEYGG 343 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.2 bits (40), Expect = 5.9 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 287 PCKVFHHNHCRFSLPQINCH 228 P HH+H +L + CH Sbjct: 281 PSLASHHSHLSSALGRSACH 300 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 19.8 bits (39), Expect = 7.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 203 N*NSWSSQNGNLFVATKNDNDCD 271 N N+ ++ NGN A+ N+N+ D Sbjct: 249 NNNNGANDNGNGNGASNNNNNGD 271 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 19.8 bits (39), Expect = 7.8 Identities = 9/36 (25%), Positives = 16/36 (44%) Frame = -1 Query: 281 KVFHHNHCRFSLPQINCHFAMTKNSNSQGSNTSAAN 174 ++ + HC + N +N N+Q +N AN Sbjct: 407 ELIRNTHCVNNNQNDNIQNTNNQNDNNQKNNKKNAN 442 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,631 Number of Sequences: 438 Number of extensions: 1863 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6471036 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -