BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11h02f (361 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59730.1 68416.m06664 receptor lectin kinase, putative simila... 31 0.30 At1g71830.1 68414.m08301 leucine-rich repeat family protein / pr... 27 5.0 At4g13620.1 68417.m02120 AP2 domain-containing transcription fac... 26 6.6 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 26 8.7 At1g66880.1 68414.m07601 serine/threonine protein kinase family ... 26 8.7 At1g63810.1 68414.m07221 nucleolar RNA-associated family protein... 26 8.7 At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kin... 26 8.7 At1g24010.1 68414.m03031 expressed protein 26 8.7 >At3g59730.1 68416.m06664 receptor lectin kinase, putative similar to receptor lectin kinase 3 [Arabidopsis thaliana] gi|4100060|gb|AAD00733; contains pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 523 Score = 30.7 bits (66), Expect = 0.30 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 270 LHY-VLLLSSPIRALSSVRWGNLPFLPPSKEKCSDRHNRHRA*CYSIS 130 LHY VL+ + P + +G +P LPP +K SDR A C +++ Sbjct: 239 LHYMVLVYTYPEAVYQPLEFGRVPTLPPYPKKPSDRLRTVLAVCLTLA 286 >At1g71830.1 68414.m08301 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 625 Score = 26.6 bits (56), Expect = 5.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +1 Query: 112 GSNTSAANAIALGAMTVVAVGTFLFTWWQERE 207 G + A +A GA + A F WW+ R+ Sbjct: 235 GITGAIAGGVAAGAALLFAAPAIAFAWWRRRK 266 >At4g13620.1 68417.m02120 AP2 domain-containing transcription factor, putative similar to AP2 domain containing protein RAP2.4 [Arabidopsis thaliana] GI:2281633; contains Pfam profile PF00847: AP2 domain Length = 388 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 255 LLSSPIRALSSVRWGNLPFLPPSKEKCSDRHNRH 154 LL S I+ +SS + N P PP K ++ N H Sbjct: 306 LLESKIQQISSSQVSNSPSPPPPKVGTPEQKNHH 339 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 25.8 bits (54), Expect = 8.7 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 87 DDQEF*FA-GQQHIRC*CYSTRRDDGCGGRNISLYLVARKGGSPTARSSRRES 242 DD EF A +++R Y +RRD R S +G SP+ SR S Sbjct: 175 DDTEFRNAFSHEYVRVREYDSRRDSRSPSRGRSYSKSRSRGRSPSRSRSRSRS 227 >At1g66880.1 68414.m07601 serine/threonine protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 1296 Score = 25.8 bits (54), Expect = 8.7 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = -2 Query: 192 PSKEKCSDRHN-RHRA*CYSISSGCV--AALRIRILGHRKMAIYLWQRKTTMIVMEHF 28 P + KC H+ + C +I++G R +I GH + ++ + ++I+ +HF Sbjct: 401 PFEVKCKPHHSPTAKFQCGNITAGFPFSGGNRPQICGHPSLELHCYNNMASIIISDHF 458 >At1g63810.1 68414.m07221 nucleolar RNA-associated family protein / Nrap family protein contains Pfam profile PF03813: Nrap protein; similar to nucleolar RNA-associated protein alpha (GI:18539461) [Mus musculus] Length = 1053 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 167 RSEHFSLLGGKKGRFP 214 RS+H S++ G +GRFP Sbjct: 726 RSQHASMINGLQGRFP 741 >At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kinase 2 (SERK2) nearly identical to somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] GI:14573457; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 2 (SERK2) GI:14573456 Length = 628 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 130 ANAIALGAMTVVAVGTFLFTWWQERE 207 A +A GA + A F WW+ R+ Sbjct: 244 AGGVAAGAALLFAAPALAFAWWRRRK 269 >At1g24010.1 68414.m03031 expressed protein Length = 141 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 106 N*NSWSSQNGNLFVATKNDNDCDGTLCTVQIE 11 N + + G + + DNDCD + TV+ E Sbjct: 78 NPDGYKKLEGTMTITHVEDNDCDRAILTVKYE 109 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,037,932 Number of Sequences: 28952 Number of extensions: 152679 Number of successful extensions: 425 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -