BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g23r (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 5.8 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 7.6 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 414 FVDKPVFIIINTNIKMYSNIN 352 F+D PVF+I+ + S +N Sbjct: 295 FIDGPVFVILTLLYSLNSCVN 315 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.4 bits (43), Expect = 7.6 Identities = 14/54 (25%), Positives = 21/54 (38%) Frame = +2 Query: 236 VNSHKIFFIITLFIS*AHLQNRVCVGLCSLVTYMYVYYKLILEYILIFVLIIMN 397 + + + T +S + V CSLV YKL L L F + M+ Sbjct: 232 IEQYNVILRYTKIVSDTYQGILVVQFFCSLVALCLTMYKLSLTEDLYFAIYEMH 285 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,701 Number of Sequences: 336 Number of extensions: 3300 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -